LOCUS E.coli 5213 bp RNA RNA ~?~???? DEFINITION Escherichia coli. ACCESSION No information KEYWORDS No information. SOURCE Escherichia coli. ORGANISM Escherichia coli. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 5213) Corresponding GenBank entry: J01695 Phylo:Eubacteria,Purple,gamma,3 BASE COUNT 389 a 352 c 487 g 314 t 3671 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- --|------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------AAA UUGAAGAGUU 661 (UGA-)U-CA U|GGCUC-AG AUUGAACGCU -G-GCGG-CA |GG-CC--UA ACAC-A-UGC 721 -AAGUCG-AA CGGUA|ACAG GAAGAAG(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------CUU G)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- -------CUU CUUUGCUG|A 961 C--GA-GU|G GCGGACGGGU GAGUAA--UG U|CUG-GGAA --AC---UGC CUGAU-GGAG 1021 GGGGAUAACU ACUG---(GA AA--)---CG GUAGCUAAUA CCGCAUA--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- -ACGUC(GCA 1141 A----)GACC AAAGAGGGGG ACC(UUCG)G G|CCUCUU-- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCCA UCGGAUGUG- --CCCAG-AU |--------- -GGGAUUA-- 1321 -GCUAGUAGG UG-GG(GUAA CGG------- ---------- ---------- ------)CUC 1381 ACCUA|---- GGCGA--CGA U|CCCUA-GC UG|---GUCU (GAGA--)GG AUGACCAGC| 1441 CACACU-GGA AC(UGAGA-C AC-)GGUCCA G|ACUCC--( UACG-)--GG AGG----C-A 1501 GCA|GUG-GG GAAUAUUGCA C-AAUGGGC( ---------- ----GCAA)G CCUGA-UGC| 1561 A|-GCCA-U- GC-CGC---- -GUGUAUGAA --GAAG-GCC (--------- UUCG------ 1621 --------)G GUUGUA-AAG -UAC|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 -----UUUCA GCGGGGAGGA AGGGAGUAAA G(UUAAUAC- )--------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------C UUUG-CUCAU UGACGUUACC CGCAGAAGAA GCACC|-GGC 1921 -UAA-C---U CCGU-G(-CC AGCAGCC-GC -GGU-AA)-U ACGGAG|--- -GGU-GCA-- 1981 AGCGU-UAAU CGG--AAUUA CUGGGC|GUA AAGCGCACGC -A-GGCG|GU UUGUUA--AG 2041 |UCAGA--UG UGAAA----U CCCCGGG(-- --CUCAA)CC UGGGA----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------AC UGCAUCUGAU ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U GGCAAGC-UU 2281 G-----AGUC -UC-GUAG-A -GGGGG--GU -----|AGAA UUCCAG-GUG ---UAGCG(G 2341 UGAAA)UGC- GUA---GAGA UCUG-GAG-G AAU------- ----ACCGGU -GGC(-GAAG 2401 -)GC|G---- ----GCCCCC U-GGACG-AA GA---CUGAC GCU--CAGGU GCGAA-AGCG 2461 U-GGG---GA GCAAACAGG( AUUAGAUAC) CCUG-GUAG| -UCCA-CGC- CGUAAA-CGA 2521 U--GUCG-AC |UU|GGAGGU UGUGCC(-CU UGA------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)GGC-GU GGCUUCC-GG AGC(UAAC)G CGUUAAGUCG 2701 A-C|--C|GC C-UGGG-GAG UACGGCC(-- -GCAA--)GG UUA--AAACU CAAAUGAA-U 2761 UG|ACGGGG- GCCCGC---A CAAGCGGU|G GAGCAUGU-G |GUUUAA-UU CG(AUGCAAC 2821 G--------- ----)CGAAG A-ACCUUACC UGGUCUUGAC AUCCACGGA- --AGUUUUCA 2881 (-------GA GA-)UGAGAA UGUGCC(-UU CG)GGAA<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->CCG-UGAG A--C---AGG UGC-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-CU CGU-|GUU(G --UGA)AAUG UUGGG(UUA- 3181 AGU)CCC-G- C-AACGAGCG CAA-CCCUUA -----UCCUU UGUUGCCAGC GG---(uccg 3241 g-)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- CCG|GGAACU CAA-AGGAGA -CUGCCA-GU (GAUA-A)AC UGG-AGGAAG 3781 -----GUG-G GGAUGA-CGU C-AAGUCAUC A|UGGC|CCU UAC------- ---------G 3841 A-C-CA-GGG CU-ACA--CA -CGUGCUACA AU--GGCGCA U-ACAA-AGA GA--AGCGA- 3901 CCUC<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G CGA--)GAGC -AAGCGGACC UCAU-AAAGU GCG-UCGUAG 4021 ---------- -----UCCGG --AUUGG-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGCAAC-UC) G-AC-U--CC -A--UGAAG- -UCGGAAUCG 4141 C-U--AGUAA U-CGUGGA(- UCAGA-AU-- --)GCCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAC--GUUC 4261 CCGGGC-CU- UGUACACA-C -CGCCCGUCA C-ACC--AUG GGA-GUGGGU UGC-AAAAGA 4321 AGUAGGUAGC UUAACC---- ---------- ---------- -(uucg--)< ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- -------GGA GGGCGCUUAC 4561 -CAC--UUUG UGAUUCAUGA CUGG-GGU-G AAGUCGUAAC AAGGUAAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUUGGAUCA CCUCCUUA-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (1)-EUKARY 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (2)-DICTYO 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.D.disco 5213 bp RNA RNA 11-JAN-191 DEFINITION mitochondria,Dictyostelium discoideum. ACCESSION No information KEYWORDS No information. SOURCE mitochondria,Dictyostelium discoideum. ORGANISM mitochondria,Dictyostelium discoideum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: D16466 Dictyostelium discoideum mitochondrial SSU rRNA sequence (from Y. Tanaka) BASE COUNT 573 a 218 c 366 g 394 t 3662 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ----AAGAAA AAAAUGAGUU 661 (UGA-)U-UC U|GGCUC-CG AAUGAAUGCU -A-UCAG-UG |GG-CU--UU AUAC-A-UGC 721 -AAGUUG-AA CGcua|uu-- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------gaaa -)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -----aau|a 961 g---A-GU|A GCAAAAAGGU GAGUAA--UG C|AUA-UGaa --uu---uua auaau-aauu 1021 uugggaaua- -------(aa ag-a)----- ---agaaauc cagaaua--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- -aaaa--gaa 1141 a-----gagg aacuugaaaa aca-guaa-g a-cuc----- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------Guua uuauaaaag- --CGUAU-GU |--------- -CGAAUUA-- 1321 -GGCAGUUGG UG-GG(GUAA AGG------- ---------- ---------- ------)CUU 1381 ACCAA|---- ACCUG--AGA U|UCGUA-GG UG|---GUUC (GAGA--)GA AUGAUCAUC| 1441 CACAUU-GGU AU(UGAAA-G AA-)CGACCA A|ACUC---( ugaa-)---G AGG----C-U 1501 GCA|GUA-AG GAAUAUUGGA C-AAUGAGC( ---------- ----GCAA)G CUUGA-UCC| 1561 A|-GCUA-C- AC-UGA---- -GUGAGGGAA --GAAg-u-- (--------- -aaa------ 1621 --------)- -gcgUA-AAC -CUC|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ----UUUUAA -uaaggaaga uaa------- -(-------- )--------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ugacaaaaau uaaAGAAGAA GUCCC|-GGC 1921 -UAA-U---U UCGU-G(-CC AGCCGCC-GC -GGU-AA)-U ACGGAG|--- -GGG-GCA-- 1981 AGCAU-UAUU CGU--AAGGA UUGGGC|GUA AAGGGUGCGU -A-GGCU|GG UUCUCA-AAG 2041 |guauu--au augaa----a aacacu-(ga aaaaaga)-g gugug----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------gg uauaaaaaca a--------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|A AAGAACC-UA 2281 G-----AGUA -AA-GAUG-A -UGUAU--UU -----|AGAA GAACUA-AUC ---UAGAG(G 2341 UAAAA)UUCa auu---uagA UUAG-UUU-G ACU------- ---gacaguU -GGC(-GAAG 2401 -)GC|A---- ----AAAUAC A--agca-a- UA---CUGAC GCU--AAAGC ACGAA-GGUU 2461 C-AGG---GA GCAAAUCGG( AUUAGAGAC) CCGA-GUAG| -UCUG-AAC- AGUAAA-CGA 2521 U--GAGU-GU |UC|aauauu ------(-cu aaaa------ ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ -aguauu-ug AGU(UAAC)A CGUUAAACAC 2701 U-C|--C|GC C-UGAG-UAG UACGAUC(-- -GCAA--)GA UUG--AAACU CAAGGUAA-U 2761 UG|ACGGAA- CUUUGC---G CAAGCAGU|G GAUUAUGU-U |CAUUAA-UU UG(AUACAAC 2821 A--------- ----)CGAAA A-AUCUUACC CUCCAUUGAA ugacauaua- ---------- 2881 ---------- ---------- ---------- -------aaa-ug-u cuaac--AGG UGU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UU CGU-|GCU(G --UGA)GGUG UAACA(UUA- 3181 AGU)UGU-G- A-AACGAACG AAA-UCCUUA ----aguuca auuacgau-- ------auau 3241 a--------- ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 --------au cga-gaaaug gacagaagag ugugacauaa auuaa-a-uc acauugguag 3781 -----UUG-A GGAAGA-UGU C-AAGUCAGU A|UGGC|CCU UAU------- ---------A 3841 G-G-AG-GGG CU-UGA--AA -UGUAAUACA AU--GGUUUC U-ACAA-AAG GA--AGCGA- 3901 AAGU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G CAA--)GCUG -GAGCAAAAC CUA--AAAAG AAA-UCUUAG 4021 ---------- -----UUUGG --AUUUA-UU U-C(------ ---------- ---------- 4081 ---------- ---------- UGCAAC-UC) G-AA-A--UA -A--UGAAA- -GCGGAAUUG 4141 C-U--AGUAA U-CGUAGA(- UCAUA-AG-- --)GCUUCGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAG--UUG- 4261 UCAAAG-UU- AGUACAUA-C -CGCCCGUCA C-ACC--ACG Gaa-aucaau cuuuuucaga 4321 uacauuauua uguuaa-uua ucuaaaguu- cuuaggguau -aacagucuc u--------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ------uuug aag--agcaa uuagaaug-- gaggagguua auuguuaauu 4561 aucgaacaau agagggguaa CUGG-GGU-A AAGUCGUAAC ACGGUAGC-U GUU-GG(GGA 4621 -A)CCA-GU- AGCUGGAAGU A--------| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (2)-MYXOMY 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.P.polyc 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Physarum polycephalum. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Physarum polycephalum. ORGANISM Mitochondrion Physarum polycephalum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X75592 DEFINITION P. polycephalum M3C mitochondrial SSU gene for 17S ribosomal RNA(pSSU) SOURCE slime mould ORGANISM Physarum polycephalum Eukaryota; Plantae; Thallobionta; Myxomycota; Myxomycetes; Myxogastromycetidae; Physarales; Physaraceae. REFERENCE 1 (bases 1 to 1861) AUTHORS Mahendran,R., Spottswood,M.S., Ghate,A., Ling,M., Jeng,K. and Miller,D.L. TITLE Editing of the mitochondrial small subunit rRNA in Physarum polycephalum JOURNAL EMBO J. 0, 0-0 (1993) REFERENCE 2 (bases 1 to 1861) AUTHORS Miller,D.L. TITLE Direct Submission JOURNAL Submitted (03-NOV-1993) MILLER D. L., The University of Texas at Dallas, Molecular and Cell Biology Program, 2601 N. Floyd Road, Richardson, Texas, U.S.A., 75080 FEATURES Location/Qualifiers source 1..1861 9 /organism="Physarum polycephalum" /strain="M3C" /clone="pSSU series" /dev_stage="Plasmodia" /clone_lib="PCR generated cDNA library of D. Miller" rRNA 1..1861 /product="mitochondrial 17S ribosomal RNA" /gene="SSU" /standard_name="mitochondrial small subunit rRNA" /label=MT-SSUrRNA /citation=[1] /note="The rRNA sequence is produced by the insertion of nucleotides not encoded by the mtDNA gene (RNA editing)" misc_feature group(33,66,127,162,177,214,238,260,288,309,502,658,675, 807 ,855,865,914,935,951,1068,1111,1128,1160,1266) /evidence=EXPERIMENTAL /label=Cinsert1 /citation=[1] /note="Cytidine insertions - RNA editing" misc_feature group(1303,1323,1355,1409,1431,1461,1480,1506,1525,1574, 1607,1624,1638,1679,1761,1790) /evidence=EXPERIMENTAL /label=Cinsert2 /citation=[1] /note="Cytidine insertions - RNA editing" misc_feature one-of(333,334) /evidence=EXPERIMENTAL /label=Uinsert1 /citation=[1] /note="Uridine insertion - RNA editing" misc_feature one-of(729,730,731) /evidence=EXPERIMENTAL /label=AAinsert1 /citation=[1] /note="Adenosine dinucleotide insertion - RNA editing" misc_feature one-of(1040,1041,1042,1043) /evidence=EXPERIMENTAL /label=CUinsert1 /citation=[1] /note="Cytidine/uridine insertion - RNA editing" misc_feature one-of(1819,1820,1821) /evidence=EXPERIMENTAL /label=AAinsert2 /citation=[1] /note="Adenosine dinucleotide insertion - RNA editing" BASE COUNT 558 a 324 c 418 g 561 t 3352 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------g uuuuaauaua auaauGAGUU 661 (UGA-)U-CC U|GGCUC-cG AGAGAAUGCU -A-GCAA-CU |UA-CU--UG AUAC-A-UGC 721 -UAGUCG-AA CGcuu|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------aua u)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -------g|a 961 g---C-GU|G GCGUACGAGC GACAAG--GG C|AAA-Gaua --ga--aaau acau--cag- 1021 ucaagg---- -------(ga aa-u)----- -------ccu aga------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- -uuuaa(-aa 1141 ga---)uuau a--------- -------ucg ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------cuga auguaa-gg- --UCUUU-GU |--------- -GAGAUUA-- 1321 -GGUUGUUGG UA-AG(AUAA AAG------- ---------- ---------- ------)CCU 1381 ACCAA|---- GCCGA--UGA U|CUCUA-GC UG|---GUCU (GAGA--)GG AUGUACAGC| 1441 CGCGUC-GGA AA(UGCAA-U AA-)GGUCCG G|ACUCC--( CUCG-)--GG AGG----C-U 1501 GCA|GUA-GG GAAUCGUGAA C-AAUGUGC( ---------- ----UAAC)G CUUGA-UUC| 1561 U|-AUAA-U- GU-UGC---- -gugggggau acaaaa-aac a------uua uuuuau---- 1621 --------ac uuauuguuuu auaaacaaau uuauauauaa aauagugaua auucuagcaa 1681 cgacuuaagc gcaauaaaag uuuccguaaa aagagauuuu uaucuguguc uucuguagcg 1741 ugccuuucua guagacggca aguugucuua aaccccuuuu uuuacgauua uaaugacugu 1801 aguuaguaua uaucuauuua ucaagaugag gguugguaaa uuacauuuug uuuguuagac 1861 uaaaauacuc gagcaaaaau gccuuaugcu gcuuugcuua aaaauaucAA ACCCC|-GGC 1921 -UAA-C---U UCGU-G(-CC AGCAGCC-GC -GGU-AA)-A ACGGGG|--- -GGG-GUU-- 1981 AGUGU-UAUU CGU--GAUGA CUGGGC|GUA AAGGGUACGU -A-GGCA|ga uaauug--aa 2041 |aauac--ag uaaaa----a acugagg(-- --uaaac)cc ucuu------ ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------ca uucuguauuc ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------ac|u cauuauc-uu 2281 g-----aguu -ca-gaag-g -cgguu--ua u----|UGAA UUCUCG-AAG ---GAAGG(G 2341 UGAAA)UCU- GUU---GAUA UCUG-GAA-G ACA------- ----UUCGAU -AGC(-GAAA 2401 -)GC|A---- ----acaucc g-auucu-g- au---CUAAC GCU--CAGGU ACUAA-AGUA 2461 U-GGG---GA UCAAAUAGG( AUUAGAGAC) CCUA-GUAG| -UCCA-UAC- CUUAAA-CAA 2521 U--GAGU-GU |UC|aacguc uuuaa-(uau agucaauaua u--------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-uu-ag gggguuu-aA AGC(UAAC)G CGUGAAACAC 2701 U-C|--C|GC C-UGGG-GAA UGUGGCC(-- -GCAA--)GG UCU--AAACU CAAAGGAA-U 2761 UG|ACGGUG- ACUUAU---A CAAGGGGU|G GAGCAUGU-G |GUUUAA-UU CG(ACAUACC 2821 G--------- ----)CGCAA A-ACCUUACC AAUUUUUG-u aucugguuuc uu-------- 2881 ---------- ---------- ---------- -------uaa-cc-a a--ugacaAG AGC-UG|CA- 3121 |UG|-AU--U |G------UC GU-AA|G-UU CGU-|GCC(G --UGA)GGUG UUGGG(UUC- 3181 AUU)CCAUA- --AACGAACG CAA-CCCUUU -----ugauu aguugcauaa uggau(---- 3241 --)<-gaaag uuuaaacugg au-------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------aucc auguucacua guucaaccag -cccuuc-ua (ccuu--)ua ggg-AUUAAG 3781 -----GAC-A GGUCCA-CGU C-AAAUCAUU A|UGGC|CUU AAU------- ---------A 3841 G-A-UU-GGG CU-ACA--CA -UGUGCUACA UU--GAUGAU CGACAA-CAA GA--AGCAA- 3901 UGGC<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)GCCU -GAGCAAAUC UUUA-AAAGA -CA-UUUCAG 4021 ---------- -----UCCGA --AUUGU-UC U-U(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uc) A-AG-A--GC -A--UGAAG- -CCGGAAUCU 4141 C-U--UGUAA U-CGUGGA(- UCAUU-AC-- --)GCCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUA--GUAC 4261 AAAAGU-CA- CGUACAGA-C -CGCCCGUCA U-GCU--AUG GAA-ACUAUU UGA-AGUAGA 4321 Agu-uacaag guuuca-a-- ---------- ---------- -(------)< uuguuucga- 4381 uagac-cacc uuauugaaag uuuuc-au-- aagg-ccuug aca-uucug- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ------uugg cuuuguacac 4561 -gac--UCUU UAUUUAGGGA CUGG-AGU-A AAGUCGAAAC AGGGUAGU-G GUA-GA(AGA 4621 -A)UCU-GC- UGCUGGACCA UUAUUA---| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (2)-CROWN 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (3)-ACANTH 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.A.caste 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Acanthamoeba castellanii. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Acanthamoeba castellanii. ORGANISM Mitochondrion Acanthamoeba castellanii. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U03732 BASE COUNT 500 a 226 c 358 g 476 t 3653 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- -------aau uccauuacuu guauaaacaa ucguuGGGUU 661 (UUA-)U-UC U|GGCUC-CG AGUGAACGCU -G-GUAA-CA |UA-UU-UUA ACAC-A-UGC 721 -AAAUCG-AA CGAA-|---- --AAGUA(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------AAU U)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- -------UAC UU------|U 961 A---A-GU|G GUGACCUGGU GAGUAG--UA U|AGG-AGAA --UU---GAA GUGUG-GGUU 1021 AGG------- ---C---(UA AA-U)---U- ---------- CCUAAAA--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- -UUAUU(AAA 1141 -----)AAUA AAAGAU---- ---(UUAU)- -----AUC-- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCCU ACAAUAGAG- --CUUCU-AA |--------- -AGGAUUA-- 1321 -GGUAGUUGU UG-UA(GUAA UUA------- ---------- ---------- ------)UUC 1381 AACAA|---- GCCGA--CGA U|GCUUA-GC UG|---GUUU (GAGA--)GA AUGAUCAGC| 1441 CACAUU-GGG AC(UGAAA-A -C-)GGCCCA A|GUCUU--( CUAA-)--AA GGG----C-A 1501 GCA|GUG-GA GAAUAUUUGA C-AAUGGGC( ---------- ----GAAA)G CUUGA-UCG| 1561 A|-GUAA-U- GU-UAC---- -GUGGGUGAU CAGAAG-GCU (--------- UAAU------ 1621 --------)U GCCGUA-AAA -CUC|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ----GUUUCG UCAAGGAUUA UAA------- -(-------- )--------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- --------UG CAAUCGUACU UGAAGGAGAA GCCCU|-GAC 1921 -UAA-C---U UCGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGGAG|--- -AGG-GCG-- 1981 AGUGU-UAUU CGC--AUUGA CUGGGU|GUA AAGGGUGCGU -A-GGUG|GU UUGUUA--AG 2041 |UUUCA--AA GUAAA----U GUUAAAC(-- --AUAAA)GU UUAA------ ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------AG GCUUUUUAAU ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U AACAGAC-UA 2281 G-----AGUU -UA-UUAG-A -AGAUA--GC -----|UGAA CAUUAA-GUG ---UAAAG(G 2341 UGAAA)UUU- UUC---GAUA UUUA-AAG-G ACA------- ----ugcaau aGGC(-GAAG 2401 -)GC|U---- ----GCUAUC U-AUUUU-AA UA---CUGAC ACU--GAGGC ACAAA-AGCA 2461 U-AGG---GA UCAAACAGG( AUUAGAGAC) CCUG-GUAG| -UCUA-UGC- CCUGAC-CGA 2521 U--GAAU-AU |UG|AUUAUA CU----(-GC GA-------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----G GUGUAAU-UA AGC(UAAC)G CGU-AAAUAU 2701 U-C|--C|AC C-UGAG-UAC UACGACC(-- -GCAA--)GG UUA--AAACU CAAAGAAA-C 2761 UG|ACGGAA- GAUUGU---A UAAGCGGU|G GAGUAUGU-G |GUUUAA-UU UG(AUAUAAC 2821 G--------- ----)CAAAG A-AUCUUACC AACCCUUGAA -UACAAGUU- ---AUUUUAG 2881 (cugu---ga ua-)AUGGAA U--------- -------ACU-UG-U A--C---AGG UGC-UG|CA- 3121 |UG|-GU--U |G------UC GG-CA|G-UU CGU-|GUU(G --UGA)AAUG UUUUG(UUA- 3181 AUU)CAU-U- U-AACGGACG UAA-CCUUCA -----GCUUU AU-uuguu-- -----(uuug 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-aaaaa AUA-GAGCAA -UAUUAA-UU (UGAA--)AA UUA-AUUGA- 3781 -----GAG-G AGAAGA-AGU C-AAAUCAUU A|UGGC|CUA UAU------- ---------A 3841 G-G-UU-GGG CU-ACA--CA -CGUACUACA AU--GGUAAU U-ACAA-UGU GA--AGCGA- 3901 AAAU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G CGA--)GUUU -UAGCUAAUC AU-U-AAAAA UUAaUCUUAG 4021 ---------- -----UUCUG --AUUAC-UC U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAg-uc) G-AG-A--GU -A--UGAAG- -UAGGAAUCG 4141 C-U--AGUAA U-CGCAGA(- AUAGA-AU-- --)GUUGCGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--AUUC 4261 UCAAUC-UU- UGUACACA-C -CGCCCGUCA C-GCC--AUG GGA-AUUggu uug-auuaga 4321 agugguauag gc------uc agauucuga- ugucuuuuaa -(uuuuuu)< uuaaaguua- 4381 ucgca-ucuu gg-------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- uacuaauuac 4561 -gac--aauu agauuAAGGA CUGG-GGU-G AAGUCGUAAC AAGGUAGC-G GUA-GG(GGA 4621 -A)CCU-GC- UGCUGGACAA AA-------| UUUUUUUAAA GG~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (3)-ALVEOL 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (4)-Apicom 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.P.falci 5213 bp RNA RNA 20-JAN-1992 DEFINITION Plasmodium falciparum. ACCESSION No information KEYWORDS No information. SOURCE Plasmodium falciparum. ORGANISM Plasmodium falciparum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: M76611 BASE COUNT 123 a 81 c 103 g 122 t 4784 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- |--------- ---------- 721 ---------- -----|---- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- ---------- ---------- -|-------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ---------- ---------- ---------- ---------- ---------- 1321 ---------- ---------- ---------- ---------- ---------- ---------- 1381 ---------- ---------- -|-------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- -|-------- ---------- ---------- 1501 ---|------ ---------- ---------- ---------- ---------- ---------| 1561 ---------- ---------- ---------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- -auuu|-GAU 1921 -CCA-U---A CAGU-C(-CC AGCGACA-GC -GGU-UA)-U ACUUUG|--- -GAAgagucg 1981 aguau-uauc cau--ccaug ucaGGC|GUu aaaagcguuc -g/....... ......-... 2041 |......... .....----. .......(-- -......).. .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .---...... -......... -.....--.. -----|.... ......-..- -----...(. 2341 .....).... ..----.... ....-....- ------.... .......... ....(-.... 2401 -)..|..... .......... .......... ..---..... ...--..... .....-.... 2461 .-...---.. .........( .........) .........| -....-...- ......-... 2521 .--....-.. |..|...... ......(... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... ...)...... .......... ...(....). .......... 2701 .--|--u|GC C-ugga-ggu uacgucca-- u-ac------ aguu-auaag caagugga-A 2761 UG|UUAGAA- GCAAAC---A CUAGCGGU|G GAACACAU-U |GUUUCA-UU UG(AUAGUAA 2821 A--------- ----)CACUA U-ACCUUACC AAUCUAUUUG /--------- ----...... 2881 (....---.. ..-)...... ......(... ..)....<.. .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .>........ .--.---... ...-..|..- 3121 ...|-..--. |..-...... .....|.-.. ....|...(. .-...).... .....(...- 3181 ...)...... --........ .......... .......... .......... .....(.... 3241 ..)<...... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... ......---- 3361 ------.... ..-------- ------.... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ---------- ---------- ---------- ----...... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 ......>... ...|...... .......... .......... (....-.).. .......... 3781 ........-. .......... ....----/u c-aaau|ugg AUG------- ---------G 3841 U-G-UU-GG- cu-ggg--ca -uuuaaucca cu--cuuuu- ---------- ---------- 3901 ----(--- -----)---- ---------- ---------- ------ag-- 4021 ---------- -----gaUUU --GAcgg-uc a-a(------ ---------- ---------- 4081 ---------- ---------- -cucaa-ua) u-ug-g--cu -gcuggAAG- -UAGAAAUCG 4141 U-U--AUUAA G-CGUCAG(- GAAGU-CC-- --)UGGACGU U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -u-------- 4261 --UUGC-CU- UGUACACA-C -CGCUCGUCA C-GCA/aucg acu-cgu--- ---------- 4321 ---------- ---------- ---------- ---------- ---------- gagguaaaa- 4381 gaa------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- -----ac-ag ucgg-UGC-G AAGUCGUAAC AUGGUAGU-U GAC-AG(UGA 4621 -A)CUU-GU- AGCUG----- ---------| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (4)-CILIOP 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.P.aurel 5213 bp RNA RNA 25-JUL-1994 DEFINITION Mitochondrion Paramecium aurelia.; 5.8S ribosomal RNA; apocytochrome; apocytochrome b; atp 9 gene; ATP synthetase; cytb gene; cytochrome c oxidase; cytochrome c oxidase subunit I; cytochrome c oxidase subunit II; dehydrogenase; dicyclohexylcarbodiimide-binding protein; NADH dehydrogenase; ND1 protein; ND2 protein; ND3 protein; ND4 protein; ND5 protein; ndh1 gene; ndh2 gene; ndh3 gene; ndh4 gene; ndh5gene; oxidase; P1 gene; P1 protein; psbG gene; ribosomal protein; ribosomal protein L14; ribosomal protein L2; ribosomal protein S12; ribosomal protein S14; ribosomal RNA; ribosomal RNA large subunit; ribosomal RNA small subunit; synthetase; transfer RNA; transfer RNA-Phe; transfer RNA-Trp; transfer RNA-Tyr. ACCESSION X15917 KEYWORDS 5.8S ribosomal RNA; apocytochrome; apocytochrome b; atp 9 gene; ATP synthetase; cytb gene; cytochrome c oxidase; cytochrome c oxidase subunit I; cytochrome c oxidase subunit II; dehydrogenase; dicyclohexylcarbodiimide-binding protein; NADH dehydrogenase; ND1 protein; ND2 protein; ND3 protein; ND4 protein; ND5 protein; ndh1 gene; ndh2 gene; ndh3 gene; ndh4 gene; ndh5gene; oxidase; P1 gene; P1 protein; psbG gene; ribosomal protein; ribosomal protein L14; ribosomal protein L2; ribosomal protein S12; ribosomal protein S14; ribosomal RNA; ribosomal RNA large subunit; ribosomal RNA small subunit; synthetase; transfer RNA; transfer RNA-Phe; transfer RNA-Trp; transfer RNA-Tyr. SOURCE Mitochondrion Paramecium aurelia. ORGANISM Mitochondrion Paramecium aurelia. REFERENCE 1 (bases 1 to 40469) AUTHORS Pritchard,A. TITLE Direct Submission JOURNAL Submitted (21-JUL-1989) to the EMBL/GenBank/DDBJ databases. Pritchard A., University of Colorado Health Science Centre, Department of Microbiology, Denver CO 80262, U S A STANDARD No information REFERENCE 2 (bases 1 to 40469) AUTHORS Pritchard,A.E., Seilhamer,J.J., Mahalingam,R., Sable,C.L., Venuti,S.E. and Cummings,D.J. TITLE Nucleotide sequence of the mitochondrial genome of Paramecium JOURNAL Nucleic Acids Res. 18 (1), 173-180 (1990) STANDARD No information REFERENCE 3 (bases 1 to 40469) AUTHORS Valverde,J.R., Marco,R. and Garesse,R. TITLE A conserved heptamer motif for ribosomal RNA transcription termination in animal mitochondria JOURNAL Proc. Natl. Acad. Sci. U.S.A. 91 (12), 5368-5371 (1994) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X15917 For overlapping sequences see accession numbers <K00904>, <M15275>, <M15220>, <K01751>, <K01749>, <X04157> and <M26930>. NCBI gi: 13256 BASE COUNT 559 a 271 c 348 g 496 t 3539 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 -------uuu aguugcagcc aggcugcaua cuuggaugua agaauucuuu uuuagGAGUG 661 (UGA-)U-CU U|AGCUU-UG AUUUAACGCU -A-AUCA-AA |UG-CA--UU ACAC-A-CGC 721 -AAGUUU-UA UUuua|caca agaaccu(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- -)uc------ 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- -------uuc uuugc(uuaa aau)-gcaaa gaucuagu|u 961 uuaaA-AU|A GCGUAUUGGU GCGUAA-aAU A|UGU-CUuu --uu---auu CGUAU-UGUA 1021 CCU----U-- --AG---(au ag-g)---CU ---------- AGGU------ ---------- 1081 ---------- ------uuuc uuccuuuuaa gaagu(uuaa ugccac)cca aaaaaaauuu 1141 u---uuaaaa aaaucgauac uua(agua)u ugaacucuuu uuuugau--- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------CCAA UAGGAAAAA- --AGAUA-UA |g-------- -AGCGCUU-- 1321 -CGAAUUCGA AG-GG(g--- -gg------- ---------- ---------- ------)CCA 1381 CUUGG|---- GCCUC--CUG C|GCUUA-GC UG|---AUUU (GUGA--)GA AGAAUCAGC| 1441 CACAUACAGG UA(UGUGA-- AA-)GACCUU A|Uc-----( u-cg-)---- -gA----C-A 1501 GAA|GUG-gg gaauuUUGGG C-AAUGCGC( ---------- ----UUAA)G CGUGA-CCC| 1561 A|-GCAA-A- UU-GAU---- -GUUGC-gAA --GAAa-aua (--------- agug------ 1621 --------)a gg-ugc-cu- -GCA|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ----gcaaug ugggau---- ---------- ---------- -augccucuu ugacuuuuuu 1801 uaaacgcagg ccagaaacga guauaauuaa gcuaa----- ---------- ---------- 1861 ---------- ---------- ---------- --------gu uuuguuagAA GCGAU|-GGC 1921 -CAA-U--AC AUGU-G(-CC AGCAGCC-GC -GGU-AA)-U ACAUGA|--- -GUA-GCU-- 1981 AGCGU-UAAU CGU--CCUUA UUGAGC|GUA CAGAGUGAGU -C-GGCG|GU Cauaac-aau 2041 |uaauaacua uuuuu----- -------(-- ---auau)-- ----a----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------aa aaga------ --uauuaa-- ---------- 2221 ---------- ---------- ---------- ---------- ------ua|a aaagGAC-UA 2281 G---UGAUUU -UU-UUUU-A -UGUAA--GU -----|UGAG CUUGUA-AAC ---UAGUG(A 2341 UAAAA)UAC- AGG---GAGU UUAC-AGG-A ACA------- ----UUCGAC --GC(-GAAA 2401 -)GC|G---- ----ACUAAC A-AUUAA-A- AA---AUGAC GCU--AUAUC ACGAA-AGUA 2461 U-AGG---UA AUGAAAAGG( cauuuuaaa) CCUA-GUAG| -UCUA-UAC- UGUAAA-AGA 2521 U--GAGU-AU |UU|------ ------(-aa uac------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ --------UA AGU(UAAC)A CA-aAAAUAC 2701 U-C|--C|GC U-UGGG-UAG UAAAGCC(-- -GCAA--)GU CAG--AAACU UAACAGAA-U 2761 UG|GCGGGG- ACUUGU---U CAAACGGU|G GAGCAUGU-G |GUUUAA-UG CG(AUAAUCC 2821 A--------- ----)CGUAA A-ACCUUAgC AGCGU-uaaa uuuuuuucuu uaguuaagcu 2881 (-------uc au-)ggcuaa aa-uuu(-uu ag)aaa-<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->aaa-ag-a g--A---UGG UAU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UU CGU-|GUU(U --UGA)AAUU UAGAA(UUA- 3181 AGU)UUUAU- A-AACGAACG CAA-CCCUUG -----UUUUG UAUG------ -----(uuu- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|----AA UAC-AAAAUA aaugauu-aa (-gga-a)uu auucauuuu- 3781 -agcuagA-A GGCUGA-AGU CAAAGUCCUU A|CGGU|CUG CGU------- ---------A 3841 C-G-CU-GGG CU-ACA--CA -CGUGUUACA AU--GGUAAA A-ACAA-UAG Aa--aaaca- 3901 aagc<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u cua-a)ccuu uaguu----U UU-A-AAAAA UUA-CCACAG 4021 ---------- -----UACGA --AUUGU-UU U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uu) G-GA-A--GC -A--UGAAG- -AAGAAAUCG 4141 U-U--AGUAA U-CGCAAA(- UAAGU-AU-- --)G-UGCGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUA--UAAG 4261 UCAAGU-CC- UGCACACA-C -UGCCCAUCA C-GCU--CAA AGA-GUUuua aau------- 4321 ---------- ---------- ---------- ---------- -(------)< cuagaagcu- 4381 gaauu-uagg augugacccu acccauuu-- uuuu-uuuua aaa-aaacuc gccggugcac 4441 caaacac-cg guguucuaaa caagcu-acu uguugucagc acaaagaaga guaaaggcga 4501 aacc------ ---------- -->------- ---------- ---------- ---------- 4561 ---------a uuugaAAUGA UCGG-AGU-G AAGUUGACAC AAGGUACC-G GUA-UG(GGA 4621 -A)CUU-GC- CGGUGGAGCA ---------| aggugaacag accaaugcau gcacc~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.prima 5213 bp RNA RNA 30-SEP-1988 DEFINITION Mitochondrion Paramecium primaurelia.; 13S ribosomal RNA; 16S ribosomal RNA; ribosomal RNA. ACCESSION K01750 KEYWORDS 13S ribosomal RNA; 16S ribosomal RNA; ribosomal RNA. SOURCE Mitochondrion Paramecium primaurelia. ORGANISM Mitochondrion Paramecium primaurelia. REFERENCE 1 (bases 1 to 1718) AUTHORS Seilhamer,J.J., Olsen,G.J. and Cummings,D.J. TITLE Paramecium mitochondrial genes: I. Small subunit rRNA gene sequence and microevolution JOURNAL J. Biol. Chem. 259, 5167-5172 (1984) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: K01750 The overall rRNA gene sequence was 94% conserved between two species (primaurelia and tetraurelia), and the nucleotide differences consisted of 53% transitions, 37% transversions, and 9% insertions plus deletions [1]. These subsitutions were somewhat clustered, and the two most divergent regions coincided with the gene boundaries. According to nuclease S1 data, the small subunit rRNA gene starts in the region (bases 25 to 45) and stops in the region (bases 1703 to 1716). Using tentative assignments of bases 30 (start) and 1710 (stop), the small subunit rDNA spans about 1680 bases [1]. BASE COUNT 560 a 277 c 341 g 509 t 3526 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 -------uuc uagccuuaau aacuaaaauu uacggaugua aggauuccuu uuuagGAGUG 661 (UGA-)U-CU U|AGCUU-UG AUUUAACGCU -A-AUCG-GG |UG-CA--UU ACAC-A-CGC 721 -AAGUUU-UA UUuua|caca agaaccu(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- -)uc------ 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- -------uuu uuugc(uuaa aau)-gcaaa gaucaagu|u 961 uuaaA-AU|A GCGUAUUGGU GCGUAA-aAU A|UGU-CUuu --uu---auu CCUAU-UGUA 1021 CCU----U-- --AG---(au ag-g)---UU ---------- AGGU------ ---------- 1081 ---------- -------uuu uuuauuuuag cuagu(uuaa aucccc)acc cccaaaagac 1141 u-uuuaaaga aaa--ucgau ccu(uaa-)g auuaaacuuu uuuuuugau- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------CCAA UAAGAAAAA- --AGAUA-UA |g-------- -AGCGCUU-- 1321 -CGUUUUCGA AG-GG(g--- -gg------- ---------- ---------- ------)CCA 1381 UUUGG|---- GCUU---CUG C|GCUUA-GC UG|---AUUU (GUGA--)GA AGAAUCAGC| 1441 CACAUACAGG UA(UGUGA-- AC-)GACCUU A|Uc-----( u-cg-)---- -gA----C-A 1501 GAA|GUG-GG GAAUUUUGGG C-AAUGCGC( ---------- ----UUAA)G CGUGA-CCC| 1561 A|-GCAA-A- UU-GAU---- -GUUGCGGAA --GAAa-aua (--------- agcg------ 1621 --------)a ggguac-cuC -GUA|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ----gcaaua cgagcu---- ---------- ---------- -uagccucuu uaacuuuuuu 1801 uaaacgcagg ccagaaacga guauaauuaa gcuaa----- ---------- ---------- 1861 ---------- ---------- ---------- --------gu uuuguuagAA GCUAU|-GGC 1921 -CAA-U--AC AUGU-G(-CC AGCAGCC-GC -GGU-AA)-U ACAUGA|--- -GUA-GCU-- 1981 AGCGU-UAAU CGU--CUUUA UUGAGC|GUA CAGAGUGAAG -C-GGCG|GU Cagaac-aau 2041 |uaauaacua uuuuu----- -------(-- ---auau)-- ----a----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------aa aaua------ --uauuaa-- ---------- 2221 ---------- ---------- ---------- ---------- ------ua|A AAAGGAC-UA 2281 G---UGAUUU -UU-UUUU-A -UGUAA--GU -----|UGAG CUUGUA-AAC ---UAGUG(A 2341 UAAAA)UAC- AGG---GAGU UUAC-AGG-A ACA------- ----UUCAAC --GC(-GAAA 2401 -)GC|G---- ----ACUAAC A-AUUAA-A- AA---AUGAC GCU--CUAUC ACGAA-AGUA 2461 U-AGG---UA AUGAAAAGG( cauuuuaac) CCUA-GUAG| -UCUA-UAC- UGUAAA-AGA 2521 U--GAGU-AU |UU|------ ------(-aa uac------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ --------UA AGU(UAAC)A CA-aAAAUAC 2701 U-C|--C|GC U-UGGG-UAG UAACGCC(-- -GCAA--)GU CAG--AAACU UAACAGAA-U 2761 UG|GCGGGG- ACUUGU---U CAAACGGU|G GAGCAUGU-G |GUUUAA-UG CG(AUAAUCC 2821 A--------- ----)CGUAA A-ACCUUACC AGCGU-uaaa uuuuuuucuu uaauuaagcu 2881 (-------ua au-)ggcuga aa-uuu(-uu ag)aaa-<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->aaa-ag-a g--A---UGG UAU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UU CGU-|GUU(U --UGA)AAUU UAGAA(UUA- 3181 AGU)UUUAU- A-AACGAACG CAA-CCCUUG -----UUUUG UAUU------ -----(uuu- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|----AA UAC-AAAAUA aaugauu-aa (-gga-a)uu auucauuuu- 3781 -agcuaaA-A GGCUGA-AGU CAAAGUCCUU A|CGGU|CUG CGU------- ---------A 3841 C-G-CU-GGG CU-ACA--CA -CGUGUUACA AU--GGUAAA A-ACAA-UAG AA--Aaaca- 3901 aagc<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u cac--)ccuu uaguu----U UU-A-AAAAA UUA-CCACAG 4021 ---------- -----UACGA --AUUGU-UU U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uu) G-GA-A--GC -A--UGAAG- -AAGAAAUCG 4141 U-U--AGUAA U-CGCAUA(- UAAGU-AU-- --)GCUGCGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUA--AAAG 4261 UCAAGU-CC- UGCACACA-C -UGCCCAUCA C-GCU--CAA AGA-GUUuca aau------- 4321 ---------- ---------- ---------- ---------- -(------)< cuggaagcu- 4381 gaauu-uagg augugacccu acccauuu-- uuuu-uuuua aaa-aaauuc gccagugcac 4441 aagugcgcug guguucuuaa caagcuuucu uguuguuagc acaaagaaga guaaaggcga 4501 aacc------ ---------- -->------- ---------- ---------- ---------- 4561 ---------a uuugaAAUGA UCGG-AGU-G AAGUUGACAC AAGGUACC-G GUA-UG(GGA 4621 -A)CUU-GC- CGGUGGAGCA ---------| UGAUGAACAG ACCAAUAUAA AUGCCcacac 4681 acgg------ ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS mt.P.tetra 5213 bp RNA RNA ~?~???? DEFINITION Mitochondrion Paramecium tetraurelia. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Paramecium tetraurelia. ORGANISM Mitochondrion Paramecium tetraurelia. REFERENCE 1 (bases 1 to 1718) AUTHORS No information JOURNAL mt.P.tetraurelia:who:published STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 5213) Corresponding GenBank entry: K01751 Phylo:Mitochondria,Protozoan,Paramecium DEFINITION Paramecium tetraurelia mitochondrial small subunit rRNA gene. SOURCE Paramecium tetraurelia mitochondrial DNA (stock 51). ORGANISM Mitochondrion Paramecium tetraurelia Eukaryota; Animalia; Protozoa; Ciliophora; Oligohymenophora; Hymenostomata; Hymenostomatida; Tetrahymenina; Glaucomidae. REFERENCE 1 (bases 1 to 1716) AUTHORS Seilhamer,J.J., Olsen,G.J. and Cummings,D.J. TITLE Paramecium mitochondrial genes: I. Small subunit rRNA gene sequence and microevolution JOURNAL J. Biol. Chem. 259, 5167-5172 (1984) COMMENT [1] the overall rRNA gene sequence was 94% conserved between the two species (primaurelia and tetraurelia), and the nucleotide differences consisted of 53% transitions, 37% transversions, and 9% insertions plus deletions. These subsitutions were somewhat clustered, and the two most divergent regions coincided with the gene boundaries. [1] according to nuclease S1 data, the small subunit rRNA gene starts in the region (bases 23 to 44) and stops in the region (bases 1698 to 1713). NCBI gi: 342986 FEATURES Location/Qualifiers source 1..1716 /organism="Paramecium tetraurelia" /mitochondrion BASE COUNT 559 a 272 c 347 g 497 t 3538 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 -------uuu aguugcagcc angcugcaua cuuggaugua agaauucuuu uuuagGAGUG 661 (UGA-)U-CU U|AGCUU-UG AUUUAACGCU -A-AUCA-AA |UG-CA--UU ACAC-A-CGC 721 -AAGUUU-UA UUuua|caca agaaccu(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- -)uc------ 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- -------uuc uuugc(uuaa aau)-gcaaa gaucuagu|u 961 uuaaA-AU|A GCGUAUUGGU GCGUAA-aAU A|UGU-CUuu --uu---auu CGUAU-UGUA 1021 CCU----U-- --AG---(au ag-g)---CU ---------- AGGU------ ---------- 1081 ---------- ------uuuc uuccuuuuaa gaagu(uuaa ugccac)cca aaaaaaauuu 1141 u---uuaaaa aaaucgauac uua(agua)u ugaacucuuu uuuugau--- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------CCAA UAGGAAAAA- --AGAUA-UA |g-------- -AGCGCUU-- 1321 -CGAAUUCGA AG-GG(g--- -gg------- ---------- ---------- ------)CCA 1381 CUUGG|---- GCCUC--CUG C|GCUUA-GC UG|---AUUU (GUGA--)GA AGAAUCAGC| 1441 CACAUACAGG UA(UGUGA-- AA-)GACCUU A|Uc-----( u-cg-)---- -gA----C-A 1501 GAA|GUG-GG GAAUUUUGGG C-AAUGCGC( ---------- ----UUAA)G CGUGA-CCC| 1561 A|-GCAA-A- UU-GAU---- -GUUGCGGAA --GAAa-aua (--------- agug------ 1621 --------)a gggugc-cuU -GCA|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ----gcaaug ugggau---- ---------- ---------- -augccucuu ugacuuuuuu 1801 uaaacgcagg ccagaaacga guauaauuaa gcuaa----- ---------- ---------- 1861 ---------- ---------- ---------- --------gu uuuguuagAA GCUAU|-GGC 1921 -CAA-U--AC AUGU-G(-CC AGCAGCC-GC -GGU-AA)-U ACAUGA|--- -GUA-GCU-- 1981 AGCGU-UAAU CGU--CCUUA UUGAGC|GUA CAGAGUGAGU -C-GGCG|GU Cauaac-aau 2041 |uaauaacua uuuuu----- -------(-- ---auau)-- ----a----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------aa aaga------ --uauuaa-- ---------- 2221 ---------- ---------- ---------- ---------- ------ua|A AAAGGAC-UA 2281 G---UGAUUU -UU-UUUU-A -UGUAA--GU -----|UGAG CUUGUA-AAC ---UAGUG(A 2341 UAAAA)UAC- AGG---GAGU UUAC-AGG-A ACA------- ----UUCGAC --GC(-GAAA 2401 -)GC|G---- ----ACUAAC A-AUUAA-A- AA---AUGAC GCU--AUAUC ACGAA-AGUA 2461 U-AGG---UA AUGAAAAGG( cauuuuaaa) CCUA-GUAG| -UCUA-UAC- UGUAAA-AGA 2521 U--GAGU-AU |UU|------ ------(-aa uac------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ --------UA AGU(UAAC)A CA-aAAAUAC 2701 U-C|--C|GC U-UGGG-UAG UAAAGCC(-- -GCAA--)GU CAG--AAACU UAACAGAA-U 2761 UG|GCGGGG- ACUUGU---U CAAACGGU|G GAGCAUGU-G |GUUUAA-UG CG(AUAAUCC 2821 A--------- ----)CGUAA A-ACCUUACC AGCGU-uaaa uuuuuuucuu uaguuaagcu 2881 (-------uc au-)ggcuaa aa-uuu(-uu ag)aaa-<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->aaa-ag-a g--A---UGG UAU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UU CGU-|GUU(U --UGA)AAUU UAGAA(UUA- 3181 AGU)UUUAU- A-AACGAACG CAA-CCCUUG -----UUUUG UAUG------ -----(uuu- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|----AA UAC-AAAAUA aaugauu-aa (-gga-a)uu auucauuuu- 3781 -agcuagA-A GGCUGA-AGU CAAAGUCCUU A|CGGU|CUG CGU------- ---------A 3841 C-G-CU-GGG CU-ACA--CA -CGUGUUACA AU--GGUAAA A-ACAA-UAG AA--Aaaca- 3901 aagc<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u caa--)ccuu uaguu----U UU-A-AAAAA UUA-CCACAG 4021 ---------- -----UACGA --AUUGU-UU U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uu) G-GA-A--GC -A--UGAAG- -AAGAAAUCG 4141 U-U--AGUAA U-CGCAAA(- UAAGU-AU-- --)GNUGCGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUA--UAAG 4261 UCAAGU-CC- UGCACACA-C -UGCCCAUCA C-GCU--CAA AGA-GUUuua aau------- 4321 ---------- ---------- ---------- ---------- -(------)< cuagaagcu- 4381 gaauu-uagg augugacccu acccauuu-- uuuu-uuuua aaa-aaacuc gccggugcac 4441 caaacac-cg guguucuaaa caagcu-acu uguugucagc acaaagaaga guaaaggcga 4501 aacc------ ---------- -->------- ---------- ---------- ---------- 4561 ---------a uuugaAAUGA UCGG-AGU-G AAGUUGACAC AAGGUACC-G GUA-UG(GGA 4621 -A)CUU-GC- CGGUGGAGCA ---------| AGGUGAACAG ACCAAUGCAU GCACC~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.T.pyrif 5213 bp RNA RNA ~?~???? DEFINITION Mitochondrion Tetrahymena pyriformis str. ST (clone pAT16, subclone TmX2.3). ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Tetrahymena pyriformis str. ST (clone pAT16, subclone TmX2.3). ORGANISM Mitochondrion Tetrahymena pyriformis. REFERENCE 1 (bases 1 to 1718) AUTHORS No information JOURNAL J. Biol. Chem. 261, 5187-5193 (1986) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: M12714 Phylo:Mitochondria,Protozoan,Tetrahymena DEFINITION Tetrahymena pyriformis mitochondrial small subunit rRNA gene. ORGANISM Mitochondrion Tetrahymena pyriformis Eukaryota; Animalia; Protozoa; Ciliophora; Oligohymenophora; Hymenostomata; Hymenostomatida; Tetrahymenina; Tetrahymenidae. REFERENCE 1 (bases 1 to 2504) AUTHORS Schnare,M.N., Heinonen,T.Y., Young,P.G. and Gray,M.W. TITLE A discontinuous small subunit ribosomal RNA in Tetrahymena pyriformis mitochondria COMMENT Draft entry and sequence in computer readable form for [1] kindly provided by M.W.Gray, 30-JUL-1986. NCBI gi: 343462 FEATURES Location/Qualifiers rRNA 783..990 /note="alpha component of small subunit ribosomal RNA" rRNA 788..990 /note="alpha component of small subunit ribosomal RNA" rRNA 1045..2451 /note="beta component of small subunit ribosomal RNA (14S rRNA)" source 1..2504 /organism="Tetrahymena pyriformis" /mitochondrion BASE COUNT 612 a 212 c 300 g 545 t 3544 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- --aaaaaaaa uuagguugua aucaaaaaau uuauuGAGUG 661 (UGA-)U-CA U|GGCUC-GG GAUUAACGCU -A-AUUA-GA |CG-CC--UA ACAC-A-UGC 721 -GAGUUU-UA UAuau|-auu agau---(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- -)(aacaauu 841 aa)------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -aucuaa--- 961 -augU-AU|A GCGUCAAGGU GAGUAU--AA U|ACAuAA-a --ua---UGC CUUUA-AGCC 1021 UAUU------ -------(ua aa-u)----- ---------A AUAG------ ---------- 1081 ---------- ---------- uuaauuuuaa aacaa(uaac aaaugc)uau a[aaaaacaa 1141 u---uauaaa uuauaauaaa caa(uca-)u auaauucuuu aaaaccaaaa aa]auuauua 1201 gca------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU AAAGAUUAA- --UUUGU-AU |--------- -AAUAUUA-- 1321 -GGUAAUUAU UU-cuaaaau uguuuaauaa aua------a auauauuuau uuuuag-UaA 1381 AAUAA|---- GCCU---AGA U|GUUUA-GU UG|---AAUU (UAGA--)GA UUGUUCAAC| 1441 CACAUACGGG UA(UGAAA-- AC-)UACCCU A|Uc-----( uauuu)---- -gA----C-A 1501 GCA|GUG-AG GAAUUUUGGA C-AAUAUGC( ---------- ----GAAA)G CAUGA-UCC| 1561 A|-GCGA-A- CU-AAU---- -GGAAACGAA --GAAG-AUA (--------g acaa------ 1621 --------)U AUUGUA-AAG -UUU|a---- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ----gugcg- -agaau---- ---------- ---------- --uaacaaau gaguau---- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- --------au ucuaggAgAA GCUCU|-GGC 1921 -UAA-U--AC AUGU-G(-CC AGCAGCC-GC -GGU-AA)-U ACAUGA|--- -GGA-GCG-- 1981 AGCGU-UAUC CAU--AUUGA CUGAGU|GUA UUAAAUACGU -A-GGAU|GU UAUAAU-UAC 2041 |uac-uuuaa aaaug----u aauaaaaa-- --cuaaauac u--------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------guag uu-------- ---------- 2221 ---------- ---------- ---------- ---------- -----auu|u uauaAAC-AA 2281 u-----AAUU -AU-AAUU-A -AGAGU--AG -----|GAGA CUUAUA-GAA ---CAACG(A 2341 UUAAA)UGU- AGU---UACA CUAU-AUA-G CUA------- ----GCCAUA -AAC(-UAAG 2401 -)GU|G---- ----CUUCUC U-AAUUA-U- AA---UUUUA UCU--GAUGU AUGAA-AGUA 2461 C-GGG---UA UCGAUGAGG( AcUAGucuC) CCUA-GUAG| -UCCG-UAC- UGUAAA-AGA 2521 U--GAAU-AC |UU|Uaugaa uu----(-ac g--------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----a auucAGGAAU AGC(UAAC)G C--aAAGUAU 2701 U-C|--U|GC U-UGGG-GAG UAUUAUC(-- -GCAA--)GA UUA--AAACU UAACUGAA-U 2761 UG|GCGGGA- AUUUGU---U CGAACGGU|G GAACAUGU-G |GUUUAA-UG CG(AUAAUCC 2821 A--------- ----)CGCAA A-AUCUUACC AACGUUUuag -gcuuua--- ---------- 2881 ---------- ---------- ---------- --------ua-aa-g u--A---CGG AAU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UU CGU-|GCU(G --UGA)AGUU UAGGA(UUA- 3181 AGU)UCUUUu u-AACGAAUG CAA-CCCUAU ---------- ---------- -----(---- 3241 --)--- ---|------ ---------- ---guau-ac (-cug-a)au aua-gggguu 3781 ------UU-A GGCUGA-AGU C-AAGUCCCU A|UGGU|CUU UAU------- ---------A 3841 C-G-UU-GGG CU-ACA--CA -CGUGUUACA AG--GGUAAA A-ACAA-AGA GA--CGCAA- 3901 UAGA<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UAA--)UCUG -GAGCAAAAC UC-U-AAAAA UUA-CCUCAG 4021 ---------- -----UUCAG --AUUGU-CU C-A(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) U-GA-G--GC -A--UGAAG- -AUGAAAUCG 4141 U-U--AGUAA U-UGUAAA(- UUAAA-AU-- --)GUUACAG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUA--UUAG 4261 UCAAAU-UU- UGCACACA-C -CGCCCAUCA C-GCU--CGG AAA-GUCaau auu-ag---- 4321 ---------- ---------- ---------- ---------- -(------)< cggaagauu- 4381 ugaaa-aucu cuacggaaua auaaauuu-- aaua-uuaau uua-uuaguc auuauguuuu 4441 uuuuuaacgc uguggaugga aaguaguauc uaau------ ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------cua auauuGGUAA UCUG-AGU-G AAGUUGACAC AAGGUACU-G GUA-GG(GGA 4621 -A)CCU-GU- UGGUGGAAUA ---------| uauuauuau~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.N.ovali 5213 bp RNA RNA 15-DEC-1998 DEFINITION Nyctotherus ovalis.; small subunit ribosomal RNA; small subunit rRNA. ACCESSION Y16670 KEYWORDS small subunit ribosomal RNA; small subunit rRNA. SOURCE Nyctotherus ovalis. ORGANISM Nyctotherus ovalis. REFERENCE 1 (bases 1 to 1701) AUTHORS Vogels,G., Veenhuis,M. and Hackstein,J. Akhmanova,A., Vonken,F., van Alen,T., Van Hoek,A., Boxma,B., TITLE A hydrogenosome with a genome JOURNAL Nature 396, 527-528 (1998) STANDARD No information REFERENCE 2 (bases 1 to 1701) AUTHORS Akhmanova,A.S. TITLE Direct Submission JOURNAL Submitted (26-FEB-1998) A.S. Akhmanova, Department of Cell Biology and Genetics, Erasmus University Rotterdam, PO Box 1738, 3000 DR Rotterdam, NETHERLANDS STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Y16670 BASE COUNT 464 a 323 c 459 g 455 t 3512 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ucguuuuagu uggagaacgu aauucacuag cuauuGAGUA 661 (UGA-)C-UA U|AGCUC-UG AGUGAAUGCG -U-GCUG-GC |GA-UC--UA AUAC-A-UGC 721 -CAGUCG-AC agccu|uaca -------(uu auaguaaguc uguggcguag u--------- 781 ---------- ---------- ---------- ---------- ---------- -)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -----ugu-- 961 -gagc-aa-g ag-cggagGU Guuaagccua g-ggu-uuga --cau--aaa gagga-ccua 1021 uacu---u-- --uu---(cc ga-a)---aa ---------- -uau-uguuc uggaauaaaa 1081 ugucaaauac uguucgagcg acuauucgau uauguggggc cuuuaugguc gauuagauag 1141 ucucucgugg caaaaagaaa guu------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- -------ugc ccgggucgc- --aucuc-cg -ug------- -cgguc---- 1321 -ugguu-aug au-ac(guag aua------- ---------- ---------- ------)gua 1381 uua-g----- cca----aua a|CCGUA-GG UG|---AACU (GAGA--)GG UUCUACACC| 1441 CACAUC-GUU AA(UGAGA-- AA-)--AACG A|Ucggggc( a-uau)uccc cgA----C-U 1501 GCA|GUA-gu gaaucUUGAC C-AAUGGGC( ---------- ----UGUU)G CCUAA-GUU| 1561 U|-GUC--G- UC-GGC---- -ggguga--- -----a-gcu (--------- auc------- 1621 --------)a gcu------u -cau|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ----aggucu auugagaaa- ---------- ---------- ---------- ---------- 1801 ---------- ---------- -uauaau-ga gcuaa----- ---------- ---------- 1861 ---------- ---------- ---------- -------ucu cgacagagAA UGAGU|-GAC 1921 -UAA-C---A ACGU-G(-CC AGCAGUU-GC -GGC-AA)-G ACGUUG|--- aACU-CGA-- 1981 AGCGU-UACU GGU--CCUGA UUGGGC|GUA AAGUAUAGCU -A-GGCG|GC Uaacgu-agu 2041 |uaugguuua uaaac----- -------(-- --gggcg)-- ----g----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------uu agaacgugca cuccauaa-- ---------- 2221 ---------- ---------- ---------- ---------- -----aac|c guuaUGC-u- 2281 ----ugGGAU -AU-AUCG-U -AGGUC--UU uc---|GGUA CGCGCA-CCU ---UAGCG(A 2341 UAAAA)UGC- GGA---AAGG GUGC-UAU-G GAC------- ---aUUCCAG --UG(-GCCA 2401 -)CG|G---- ---cGGGGCU C-AGAUA-U- AU---CCGAC GCU--GAACU AUUAA-AGUG 2461 U-GGG---GG CCAAAAAGG( AUUAGGGAC) CCUU-GUAG| -CCCA-CAC- CCUGAAuucA 2521 U--GAAC-AU |UG|aucggu auu---(-ua au-------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----gg uacugau-UC AGC(UUAC)G CG-uAAAUGU 2701 U-U|--C|GC C-UGGG-GAA UAAUACC(-- -GCAA--)GG UAG--AAAGC UAAUGAGA-U 2761 UG|GCGGGA- GCUUGU---A UAAACAAU|G GGGCACGU-G |GCUCAA-UU CG(ACAAUAC 2821 A--------- ----)CGUAA A-AUCUUACC CGUAA-gaug ugaggugcg- ---uuacgua 2881 (aucuguagu uuc)uacgua g--------- -------<-- ---------- ---------- 2941 ---------- ------acgc gacaacgccu aaguugcguc ugguuaugua aucgcgacua 3001 uagacagaac acgauaaaua ugugcuggcu gcgua----- ---------- ---------- 3061 ---------- ---------- ---------a a>cga-cc-u c--u---GGG UGC-UG|CA- 3121 |UG|-GC--U |G------UC GU-AA|A-UU CAU-|GCC(G --UGG)GGUG UGGUU(UUU- 3181 GGU)AAC-U- G-AAUGAAUG CGA-CCUAUG ---------- ---------- -----(---- 3241 --)--- ---|------ --------gu aagucua-ua (-ucg-u)ug cggaggucc- 3781 -caagguc-u aggaCA-CGU C-AAGUCAAC A|UGGU|CUU AAU------- ---------A 3841 U-G-CG-GGG CU-GCA--CA -UGUGCCACA AG--GGCAAA G-ACAA-AAU Ga--ugcua- 3901 aggu<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--- gcg--)agcc aaagc--aau cuucuAAAAA UUG-UCACAG 4021 ---------- -----UUCAG --AUUGU-AC G-U(------ ---------- ---------- 4081 ---------- ---------- UGCAAa-uc) A-UG-U--AC -A--UUAAG- -UAGUAAUUG 4141 U-U--AGUAA U-CGUACC(- UGGGU-A--- --)A-AGUGC C-acgguga- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUG--UUAU 4261 UCGAGC-UU- UGCACACA-C -cGCCCAUCA C-GCU--agg gga-gagacc ggug------ 4321 ---------- ---------- ---------- ---------- -(------)< cuggaa---- 4381 gaauu--auc uuacaguuug cggacugg-- gggu-uuuua aaa------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ------ggaa acgguuucaa ccag-agc-u AAGUUGACAC AAGGUAGC-G GUA-GU(AGA 4621 -A)ACU-GC- UGCUGGAGUA ---------| gcuaucaaag ugggauaaug uacc------ 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS (3)-CHLORA 5213 bp RNA RNA 25-JAN-1994 DEFINITION CHLORARACHNIOPHYCEAE. ACCESSION No information KEYWORDS No information. SOURCE CHLORARACHNIOPHYCEAE. ORGANISM CHLORARACHNIOPHYCEAE. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.Chlo.sp 5213 bp RNA RNA 11-JAN-191 DEFINITION Chlorarachnion sp. ACCESSION No information KEYWORDS No information. SOURCE Chlorarachnion sp. ORGANISM Chlorarachnion sp. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U36908 LOCUS U36908 1911 bp DNA PLN 26-OCT-1995 DEFINITION Chlorarachnion sp. CCMP 621 small subunit ribosomal protein 14 (rps14) gene, partial cds, small subunit ribosomal protein 12 (rps12) gene, complete cds, and small subunit ribosomal RNA gene. ACCESSION U36908 KEYWORDS . SOURCE Chlorarachnion sp. strain=CCMP 621. ORGANISM Mitochondrion Chlorarachnion sp. Eukaryotae; mitochondrial eukaryotes; Chlorarachniophyceae; Chlorarachnion; Chlorarachnion sp. REFERENCE 1 (bases 1 to 1911) AUTHORS Gilson,R., McFadden,G.I. and Waller,R.F. TITLE Preliminary Characterisation of Chlorarachniophyte Mitochondrial DNA JOURNAL J. Eukaryot. Microbiol. 42 (1995) In press REFERENCE 2 (bases 1 to 1911) AUTHORS Gilson,R., McFadden,G.I. and Waller,R.F. TITLE Direct Submission JOURNAL Submitted (21-SEP-1995) Paul Gilson, Botany, University of Melbourne, Melbourne, Vic 3052, Australia COMMENT NCBI gi: 1040983 FEATURES Location/Qualifiers source 1..1911 /organism="Chlorarachnion sp." /strain="CCMP 621" /mitochondrion /note="derived from two contiguous HindIII restriction fragments of mitochondrial DNA. The entry contains the complete sequence of one HindIII fragment and a partial sequence of the next contiguous HindIII fragment" CDS <1..163 /gene="rps14" /note="NCBI gi: 1040984" /codon_start=2 /product="small subunit ribosomal protein 14" /translation="SLRLALICPGLLPIRNICVATSRSRGVFRKYKLSRIMLRDMGLQ GLLPGFKKR" CDS 168..548 /gene="rps12" /note="NCBI gi: 1040985" /codon_start=1 /product="small subunit ribosomal protein 12" /translation="MATSNQMGANTRSKKKKKNLKKALLGCPQKRGVCMRLLTRSPKK PNSAQRRVAKVRLSTKRVIFAHIPGEGHNLSPFSVVLVRGGNVRDLPGVRYKTIRGVK DLAPVLSRTNGRSKYGTKRPKVHT" rRNA <572..>1911 /note="the exact ends of the rRNA are uncertain" /product="small subunit ribosomal RNA" BASE COUNT 556 a 395 c 524 g 435 t 1 others ORIGIN BASE COUNT 372 a 283 c 389 g 295 t 3874 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------U AUACCGGGUU 661 (UGA-)U-CC U|GGCUC-AG AGUGAACGCU -A-GGGG-UA |CG-CA--UA ACAC-A-UGC 721 -GAGUCA--a cg---|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------uau -)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- --------|- 961 ----c-gu|G GCGAACGGGU GAKUAC--AG C|AGG-caau --ua---CGC CCGGU-AGcc 1021 cagaa----- -------(ua aa--)----- -------uuc uggauaa--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- aaa------- -ga(uuaa)u c|-------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GUUG CCGGAUAUG- --ucUGU-GU |--------- -AGGAUUA-- 1321 -GAUAAUC-- -----(GUAG A--------- ---------- ---------- ------)--- 1381 ---GA|---- GUCGA--UGA U|CCUUA-GU UG|a--AUCU (GGGAA-)GG AUGCACAGC| 1441 CACAUU-GGA AC(UGAGA-C AA-)GGUCCA A|gcucc--( agua-)--gg agg----C-A 1501 GCA|GUG-AG GAAUAUUGGG C-AAUGGGC( ---------- ----GAAA)G CCUGA-CCC| 1561 A|-ACGA-U- AC-CCC---- -GUGAUUGAA --GAAG-AC- (--------- caag------ 1621 --------)- GUCGUAAAGG -UAC|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ------gcgg ucaguaaaga uua------- -(-------- )--------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- cgacgguaac uggccaaaaA GCCCC|-GGC 1921 -UAA-C---U CCGU-G(-CC AGCAGCC-GC -GGU-AA)-U ACGGGG|--- -GGG-GCA-- 1981 AGUGU-UAUU CGC--AAUGA CUGGGC|GUA AAGCGUGCGU -A-GGCG|gc uugcaauuag 2041 |cccuu--uu gcgaa----a gcuaggg(-- --cucaa)cc uuagu----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------gu gacuuuuggc ---------- ---------- 2221 ---------- ---------- ---------- ---------- -------A|C AGCAAGC-UA 2281 G-----AGUU -UG-GUAG-G -GGUUG--GU -----|AGAA UUCUCA-GAA ---GAGGG(G 2341 UACAA)UCC- AGG---GACA CUGA-GAC-G AAU------- ----ACCUAG -GGC(-GAAG 2401 -)GC|A---- ----GCCAAC U-GGACC-AU -A---CUGAC GCU--AAAGC ACGGA-AGCG 2461 U-AGG---UA GCAAAUAGG( AUUAGAUAC) CCUA-GUAG| -UCUA-CGC- CGUCAA-CGA 2521 U--GGGU-AU |UG|GCAAu- ------(--u aa-------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ --auugc-UA AGC(UAAC)G CGUUAAAUAC 2701 C-C|--C|GC C-UGGG-GAG UACGGUC(-- -GCAA--)GA UUA--AAACU UAAAGGAA-U 2761 UG|ACGGGA- GCUUGC---G CAAGCGGU|G GGGCAUGC-G |GUUUAA-UC CG(AUAUUAC 2821 A--------- ----)CGUAA A-AUCUUACC AACCCUUgaa caa------- ---------- 2881 (--------- ---)------ ------(--- --)----<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->-------- A--C---AGG UGU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-CC CGU-|GUC(G --UAA)GAUG UUUGG(UUA- 3181 ACU)CCU-U- U-AACGGGCG UAA-CCCCU- -----cuc-- ---------- -----(uucg 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---------- -----gagca -CCGCUG-UU (GAAA-U)AA CAG-GGGGAG 3781 -----GUA-G GGAUCA-CGC C-AAGUCGUC A|UGGC|CCU GAU------- ---------G 3841 G-G-UU-GGG CU-ACA--CA -UGUGUCACA UA--GUUGCA U-ACAG-CGA GA--GGCAA- 3901 agac<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--A AAA--)GUCG -GAGCA-AUC U-AU-AACGU GCA-ACCCAG 4021 ---------- -----UUCGG --AUUAU-CU C-C(------ ---------- ---------- 4081 ---------- ---------- UGCAAC-UC) G-GA-G--AU -A--UGAAG- -GCGUAAUCG 4141 C-U--AGUAA U-CGCGUA(- UCAUA-AU-- --)GGCGCGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAC--GUGA 4261 UCAAGC-UU- UGUACACA-C -CGGCCGUCA C-GAC--cgg aaa-gucagc uuu-gcuuga 4321 augguu-cgc agugau-cgc uu-------- ---------- -gcuucgug- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- ---------- ---------- ------aagc guaacugucu 4561 cuugauagua gggucgaUGA UCGG-GGC-G AAGUCGUAAC AGGGUAGC-U GUA-GG(GGA 4621 -A)CCU-GU- AGCUGGAGAA AA-------| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (3)-F/M_GR 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (4)-FUNGI 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (5)-ASCOMY 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (6)-ARCHIA 5213 bp RNA RNA 25-JAN-1994 DEFINITION ARCHIASCOMYCETES. ACCESSION No information KEYWORDS No information. SOURCE ARCHIASCOMYCETES. ORGANISM ARCHIASCOMYCETES. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.S.pombe 5213 bp RNA RNA ~?~???? DEFINITION Mitochondrion Schizosaccharomyces pombe. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Schizosaccharomyces pombe. ORGANISM Mitochondrion Schizosaccharomyces pombe. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X54421 Schizosaccharomyces pombe mt SSU rRNA (spo m ssu) Unpublished (from K. Wolf through B.F. Lang) BASE COUNT 485 a 203 c 280 g 454 t 3791 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- --------au aaaaauauau auaauGAGUU 661 (UGA-)U-GU U|AGCUC-GG UUAUAACGCU -A-UCUA-GA |GA-UU-UUA ACAC-A-UGC 721 -AAAUCG-AA CGaau|caa- caaaaac--- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --aauacauc 841 cu(uuag)-- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ------ggga uguuuguguu uuuuugu-|g 961 a---C-GU|G GUGAACAGGU GAGUAA-a-A G|GGA-AGAA --CG---GAC CUUAA-AUUU 1021 CGGc------ -------(ua aa-u)----- ---------u CCGAAUA--- ---------- 1081 ---------- ---------- ---aacacac ucuuuuggag uguugugaaa gaagug(aaa 1141 a----)cuuu ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GAUU UAAGACUGG- --CUUCU-UA |--------- -CGAUUAA-- 1321 -AGUAGUUGG AG-AG(GUAA AAG------- ---------- ---------- ------)CUU 1381 AACAA|---- GCUCA----A A|UCGUA-AU CA|ugACACU (AAGU--)GG UGCUCUGAU| 1441 CACAUU-GGC UC(UGAGA-- CAA)CAGCCA A|GAUgaac( auuua)guuc AUC----C-A 1501 GCA|GUG-GA GAAUAUUAGU C-AAUGAUC( ---------- ----GAAA)G AUUGA-ACU| 1561 A|-GUCA-U- CU-AGA---- -AGAGUGAAA --CUuu-ua- (--------- guua------ 1621 --------)- uagcuccuua aauu|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 -----aagaa aauu------ ---------- --ugauucuu ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------a auuuuauguA AUUCU|-UGC 1921 -CAA-U--UU CCGU-G(-CC AGCAGCA-GC -GGU-UA)-U ACGGAU|--- -AGA-AUA-- 1981 AGCGU-UUAA CAU--AAUAA AAAGGC|CUA AAAAGUAUGU -A-GAUG|GA AAAAaa---- 2041 |--------- ---------- -------(-- ---caaa)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|u cUUUUUC-UA 2281 G-----AGUA -AU-AAag-a -UGUUU--GU -----|AGUA UUGUCA-AAU ---AAGGG(A 2341 UCAAA)UCC- GAC---AAUC UUGA-UGA-G ACU------- ----GCU-UA -AGU(-AAAA 2401 -)AC|U---- ----ACUUAC A--aUUaAU- UA---CUGAC AUU--GAGAU ACGAA-GGCU 2461 U-AGA---UC GCGAAAGAG( AUUAGAUAC) CUCU-GUAG| -UCUA-AGC- UGUAAA-CGA 2521 U--UAUU-GC |UC|UCCCAA UCU---(-uu u--------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----UG AUUGGGU-UU AGU(GAAG)A CGguAAGCAA 2701 U-A|--U|GC C-UGGG-GAG UACUUUC(-- -GCAA--)GA UUG--AAACC CAAAACAU-U 2761 AG|ACGGUC- UUGGAA---A UCCGCAGU|G AAUCAUGU-U |AUUUAA-UU AG(AUAAUCC 2821 G--------- ----)CUAAA A-AUCUUACC UUUCCUUAAA -acaauua-- ---------- 2881 (-------gu uu-)------ ---------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uaa-uu-g u--U---GGG UAU-UG|CA- 3121 |UG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UAA)GAUg a--GG(UUA- 3181 AUU)CC-caU U-AAUUAACG AAA-GCCUUC -----AAAGA A--------- -----(---- 3241 --)--- ---|------ -UU-CUUUG- --UGUUA-GU (GAUA-A)GC UAA-CUUUU- 3781 -----UAG-A GGGUUA-AGA C-AAGUCAAU A|UGAU|CCU UAU------- ---------G 3841 G-A-AA-GGG CU-AUA--GA -CGUGAUAUA AA-AUCUAAU C--CAA-UAA U---Uuuuaa 3901 uauc<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--g aaa--)gauu -gaaguauua UUAU-AAUGG UUAGGAgauu 4021 ua-------- -----UUCAG --AUUUA-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAu-uu) G-AU-U--UA -A--UGAAG- -GAGGAAUUG 4141 C-G--AGUAA U-CACUAA(- UCAUU-AC-- --)GUAGUGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--U-AU 4261 CUCUGA-GA- UGUACUAA-C -UACUCGUCA A-GCG--CUG AAA-GUAu-- ---------- 4321 ---------- ---------- ---------- ---------- ---------< ---------- 4381 ---------- ---uaaucuc uugaagaaga ca(uucauu) ------- ---------- ---------- ---------- 4561 ---------- ----gUGCAA UUAG-UGU-U AAGUCGAAAU AAGGUAAC-C GUA-GU(GGA 4621 -A)GUU-GC- GGUUGAACUA ---------| AUUAAUUCAG GUUAACCCCC CCCC~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (6)-EUASCO 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (7)-PLECTO 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.E.nid.1 5213 bp RNA RNA 29-JAN-1982 DEFINITION Mitochondrion (Emericella) Aspergillus nidulans. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion (Emericella) Aspergillus nidulans. ORGANISM Mitochondrion (Emericella) Aspergillus nidulans. REFERENCE 1 (bases 1 to 1701) AUTHORS No information JOURNAL 751(1981) STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 5213) Corresponding GenBank entry: J01393 Phylo:Mitochondria,Fungi,Aspergillus DEFINITION a.nidulans mt small ribosomal subunit rna gene. SOURCE aspergillus nidulans mitochondria. ORGANISM Mitochondrion Emericella nidulans Eukaryota; Fungi; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae. REFERENCE 1 (bases 1 to 1437) AUTHORS Kuntzel,H. and Kochel,H.G. TITLE evolution of rrna and origin of mitochondria JOURNAL Nature 293, 751-755 (1981) COMMENT this sequence is compared to the s-rrna gene sequences of yeast (s.cerev.), man, mouse, e.coli and maize. cf ystrg18sa, hummt, musmt, ecorgrrnb and mzecp16srr. NCBI gi: 336909 FEATURES Location/Qualifiers source 1..1437 /organism="Emericella nidulans" /mitochondrion ORIGIN putative 5' end of primary transcript BASE COUNT 500 a 209 c 299 g 429 t 3776 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------aaa auuuuGAGUU 661 (UGA-)U-GA U|GGCUC-UG AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---auua--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa-a)----- --------UC CCUUAUA--- ---------- 1081 ---------- ---------- ---------- ---------- -----AAAAG AAAGGAaaaa 1141 gaagg-UCC- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUUA-UU |a------uC ACGG--UG-- 1321 -AGUAGUAGU AA-AG(GUAA uga------- ---------- ---------- ------)CUU 1381 UACUA|---- GCUAA----A U|CCGUA-GU CG|--uGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( uu-u-)--a- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GC-GA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGAAA --GUGU-AUU (--------a uaau------ 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )auaucguau aaaauucuaa 1801 auagaauaau gauaaugaca auuuucuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAaC---U ACCU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAAU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGU ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UAUUUAC-UA 2281 G-----AGUU -UU-AUgu-a -AGAAG--GA -----|AGAA GCUCUG-GAG ---UAGUG(A 2341 UAUAA)UAC- GUA---UAUA CCAG-AGA-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAGAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGACAA-UGA 2521 U--GAAU-GU |CA|UAGACU AGAaaa(agu cguuuagacu au-------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)aaa-UU UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAG---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUGAUCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUUUGAA Uau------- ---------- 2881 (--------u u--)------ ---------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->-------u a--C---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UU UU-UA|G-UU AAU-|GUC(G --UGA)GAUC U--GG(UUA- 3181 AGU)CCU-U- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(cauu 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auaaaguuGA -UCGCCU-U- (UAUA-U)-- UGGuu-AGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUU AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--UGCCUU U-ACAA-AGG GA--UGCGA- 3901 UUUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UG---)AAAu uGAGCUAAUC CCCC-AAAAA AGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUA--A-AA 4261 AUCAGC-UG- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GAAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< gaaguuugau 4381 uuacu-uaua uuuauaauau auauaa(uca g)uuauauau auuuauaagu uaaauuuucg 4441 ca-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AUGGUUCG-U GUA-AU(GGA 4621 -A)AUU-GC- ACGGGAUGAA -----UUA-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.alber 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Petromyces albertensis NRRL 20602. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Petromyces albertensis NRRL 20602. ORGANISM Mitochondrion Petromyces albertensis NRRL 20602. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29229 LOCUS PAU29229 1372 bp DNA PLN 02-JAN-1996 DEFINITION Petromyces albertensis NRRL 20602 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29229 NID g1144033 KEYWORDS . SOURCE Petromyces albertensis. ORGANISM Mitochondrion Petromyces albertensis Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; Petromyces. REFERENCE 1 (bases 1 to 1372) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1372) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144033 FEATURES Location/Qualifiers source 1..1372 /strain="NRRL 20602" /organism="Petromyces albertensis" /mitochondrion rRNA <1..>1372 /product="small subunit ribosomal RNA" BASE COUNT 476 a 209 c 283 g 404 t ORIGIN BASE COUNT 476 a 209 c 283 g 404 t 3841 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUu----- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaua-- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc cCGG--GU-- 1321 -AGUAGUAGG AA-AA(GUAA UGA------- ---------- ---------- ------)UUU 1381 UUCUA|---- GCUAAaa--- -|CCGUA-GU CG|--AGACU (GAGA--)-G UCAAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a uuau------ 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 uaaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(uaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaaugaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.all.1 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Petromyces alliaceus NRRL 315. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Petromyces alliaceus NRRL 315. ORGANISM Mitochondrion Petromyces alliaceus NRRL 315. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29231 LOCUS PAU29231 1372 bp DNA PLN 02-JAN-1996 DEFINITION Petromyces alliaceus NRRL 315 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29231 NID g1144035 KEYWORDS . SOURCE Petromyces alliaceus. ORGANISM Mitochondrion Petromyces alliaceus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; Petromyces. REFERENCE 1 (bases 1 to 1372) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1372) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144035 FEATURES Location/Qualifiers source 1..1372 /strain="NRRL 315" /organism="Petromyces alliaceus" /mitochondrion rRNA <1..>1372 /product="small subunit ribosomal RNA" BASE COUNT 476 a 209 c 283 g 404 t ORIGIN BASE COUNT 476 a 209 c 283 g 404 t 3841 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUu----- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaua-- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc cCGG--GU-- 1321 -AGUAGUAGG AA-AA(GUAA UGA------- ---------- ---------- ------)UUU 1381 UUCUA|---- GCUAAaa--- -|CCGUA-GU CG|--AGACU (GAGA--)-G UCAAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a uuau------ 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 uaaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(uaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaaugaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.all.2 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Petromyces alliaceus NRRL 5108. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Petromyces alliaceus NRRL 5108. ORGANISM Mitochondrion Petromyces alliaceus NRRL 5108. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29230 LOCUS PAU29230 1372 bp DNA PLN 02-JAN-1996 DEFINITION Petromyces alliaceus NRRL 5108 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29230 NID g1144034 KEYWORDS . SOURCE Petromyces alliaceus. ORGANISM Mitochondrion Petromyces alliaceus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; Petromyces. REFERENCE 1 (bases 1 to 1372) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1372) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144034 FEATURES Location/Qualifiers source 1..1372 /strain="NRRL 5108" /organism="Petromyces alliaceus" /mitochondrion rRNA <1..>1372 /product="small subunit ribosomal RNA" BASE COUNT 476 a 208 c 283 g 405 t ORIGIN BASE COUNT 476 a 208 c 283 g 405 t 3841 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUu----- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaua-- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GU-- 1321 -AGUAGUAGG AA-AA(GUAA UGA------- ---------- ---------- ------)UUU 1381 UUCUA|---- GCUAAaa--- -|CCGUA-GU CG|--AGACU (GAGA--)-G UCAAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a uuau------ 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 uaaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(uaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaaugaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.clava 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus clavatoflavus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus clavatoflavus. ORGANISM Mitochondrion Aspergillus clavatoflavus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29232 LOCUS ACU29232 1375 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus clavatoflavus NRRL 5113 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29232 NID g1144036 KEYWORDS . SOURCE Aspergillus clavatoflavus. ORGANISM Mitochondrion Aspergillus clavatoflavus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1375) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1375) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144036 FEATURES Location/Qualifiers source 1..1375 /strain="NRRL 5113" /organism="Aspergillus clavatoflavus" /mitochondrion rRNA <1..>1375 /product="small subunit ribosomal RNA" BASE COUNT 471 a 212 c 286 g 406 t ORIGIN BASE COUNT 471 a 212 c 286 g 406 t 3838 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AUUU AGUUuuu--- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuacug- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -----AGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----aaa-- aaaggaaauu 1141 aaaaagucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AUUCU-UU |a------uc uCGG--UG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAuag-- -|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGGAA --AUGU-AUU (--------a uaauauu--- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aauucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUaa-g -AGAAG--GU -----|AGAA UUUCUG-GAG ---UAGAG(a 2341 uagaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GAUAAC -GGC(-GAAG 2401 -)GC|A---- ----ACCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UGGGCU AGAaau(aua --u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGCCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa u--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUU-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau aGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAu-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UCU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuuuc-cuau guguuaauau auacaa(uca g)guauuuaa auacguaggu uuuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AC~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.fla.1 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus flavus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus flavus. ORGANISM Mitochondrion Aspergillus flavus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29214 LOCUS AFU29214 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus flavus NRRL 1957 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29214 NID g1144018 KEYWORDS . SOURCE Aspergillus flavus. ORGANISM Mitochondrion Aspergillus flavus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144018 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 1957" /organism="Aspergillus flavus" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.fla.2 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus flavus var. columnaris. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus flavus var. columnaris. ORGANISM Mitochondrion Aspergillus flavus var. columnaris. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29220 LOCUS AFU29220 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus flavus var. columnaris NRRL 4822 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29220 NID g1144024 KEYWORDS . SOURCE Aspergillus flavus var. columnaris. ORGANISM Mitochondrion Aspergillus flavus var. columnaris Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144024 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 4822" /organism="Aspergillus flavus var. columnaris" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.fla.3 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus flavus var. columnaris. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus flavus var. columnaris. ORGANISM Mitochondrion Aspergillus flavus var. columnaris. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29221 LOCUS AFU29221 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus flavus var. columnaris NRRL 4823 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29221 NID g1144025 KEYWORDS . SOURCE Aspergillus flavus var. columnaris. ORGANISM Mitochondrion Aspergillus flavus var. columnaris Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144025 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 4823" /organism="Aspergillus flavus var. columnaris" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.kamba 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus kambarensis. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus kambarensis. ORGANISM Mitochondrion Aspergillus kambarensis. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29219 LOCUS AKU29219 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus kambarensis NRRL 3751 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29219 NID g1144023 KEYWORDS . SOURCE Aspergillus kambarensis. ORGANISM Mitochondrion Aspergillus kambarensis Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144023 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 3751" /organism="Aspergillus kambarensis" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.lepor 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus leporis. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus leporis. ORGANISM Mitochondrion Aspergillus leporis. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29228 LOCUS ALU29228 1375 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus leporis NRRL 6599 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29228 NID g1144032 KEYWORDS . SOURCE Aspergillus leporis. ORGANISM Mitochondrion Aspergillus leporis Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1375) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1375) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144032 FEATURES Location/Qualifiers source 1..1375 /strain="NRRL 6599" /organism="Aspergillus leporis" /mitochondrion rRNA <1..>1375 /product="small subunit ribosomal RNA" BASE COUNT 475 a 209 c 286 g 405 t ORIGIN BASE COUNT 475 a 209 c 286 g 405 t 3838 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUu----- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaua-- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUau---- ---------- 1081 ---------- ---------- ---------- ---------- -----aaaag aaaggaaaau 1141 aaaaagucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--UG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a uaau------ 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuua(uau a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC UCAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.nom.1 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus nomius. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus nomius. ORGANISM Mitochondrion Aspergillus nomius. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29218 LOCUS ANU29218 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus nomius NRRL 3161 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29218 NID g1144022 KEYWORDS . SOURCE Aspergillus nomius. ORGANISM Mitochondrion Aspergillus nomius Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144022 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 3161" /organism="Aspergillus nomius" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 212 c 287 g 400 t ORIGIN BASE COUNT 475 a 212 c 287 g 400 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaacu- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----aca-- aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuccg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.nom.2 5213 bp RNA RNA 11-JAN-191 DEFINITION Aspergillus nomius. ACCESSION No information KEYWORDS No information. SOURCE Aspergillus nomius. ORGANISM Aspergillus nomius. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29225 LOCUS ANU29225 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus nomius NRRL 6108 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29225 NID g1144029 KEYWORDS . SOURCE Aspergillus nomius. ORGANISM Mitochondrion Aspergillus nomius Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144029 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 6108" /organism="Aspergillus nomius" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 212 c 287 g 400 t ORIGIN BASE COUNT 475 a 212 c 287 g 400 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaacu- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----aca-- aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuccg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.nom.3 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus nomius. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus nomius. ORGANISM Mitochondrion Aspergillus nomius. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29226 LOCUS ANU29226 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus nomius NRRL 6552 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29226 NID g1144030 KEYWORDS . SOURCE Aspergillus nomius. ORGANISM Mitochondrion Aspergillus nomius Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144030 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 6552" /organism="Aspergillus nomius" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 212 c 287 g 400 t ORIGIN BASE COUNT 475 a 212 c 287 g 400 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaacu- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----aca-- aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuccg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.nom.4 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus nomius subsp. NRRL 3353. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus nomius subsp. NRRL 3353. ORGANISM Mitochondrion Aspergillus nomius. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29227 LOCUS ANU29227 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus nomius NRRL 3353 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29227 NID g1144031 KEYWORDS . SOURCE Aspergillus nomius. ORGANISM Mitochondrion Aspergillus nomius Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144031 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 3353" /organism="Aspergillus nomius" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 212 c 287 g 400 t ORIGIN BASE COUNT 475 a 212 c 287 g 400 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaacu- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----aca-- aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuccg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.oryza 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus oryzae var. effusus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus oryzae var. effusus. ORGANISM Mitochondrion Aspergillus oryzae var. effusus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29215 LOCUS AOU29215 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus oryzae var. effusus NRRL 1958 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29215 NID g1144019 KEYWORDS . SOURCE Aspergillus oryzae var. effusus. ORGANISM Mitochondrion Aspergillus oryzae var. effusus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144019 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 1958" /organism="Aspergillus oryzae var. effusus" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.par.1 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus parasiticus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus parasiticus. ORGANISM Mitochondrion Aspergillus parasiticus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29213 LOCUS APU29213 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus parasiticus NRRL 502 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29213 NID g1144017 KEYWORDS . SOURCE Aspergillus parasiticus. ORGANISM Mitochondrion Aspergillus parasiticus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144017 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 502" /organism="Aspergillus parasiticus" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.par.2 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus parasiticus subsp. NRRL 4123. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus parasiticus subsp. NRRL 4123. ORGANISM Mitochondrion Aspergillus parasiticus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29233 LOCUS APU29233 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus parasiticus NRRL 4123 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29233 NID g1144037 KEYWORDS . SOURCE Aspergillus parasiticus. ORGANISM Mitochondrion Aspergillus parasiticus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144037 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 4123" /organism="Aspergillus parasiticus" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.par.3 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Asptergillus parasiticus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Asptergillus parasiticus. ORGANISM Mitochondrion Asptergillus parasiticus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29223 LOCUS APU29223 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus parasiticus NRRL 6433 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29223 NID g1144027 KEYWORDS . SOURCE Aspergillus parasiticus. ORGANISM Mitochondrion Aspergillus parasiticus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144027 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 6433" /organism="Aspergillus parasiticus" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.sojae 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus sojae. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus sojae. ORGANISM Mitochondrion Aspergillus sojae. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29216 LOCUS ASU29216 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus sojae NRRL 1988 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29216 NID g1144020 KEYWORDS . SOURCE Aspergillus sojae. ORGANISM Mitochondrion Aspergillus sojae Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144020 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 1988" /organism="Aspergillus sojae" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.subol 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus subolivaceus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus subolivaceus. ORGANISM Mitochondrion Aspergillus subolivaceus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29222 LOCUS ASU29222 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus subolivaceus NRRL 4998 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29222 NID g1144026 KEYWORDS . SOURCE Aspergillus subolivaceus. ORGANISM Mitochondrion Aspergillus subolivaceus Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144026 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 4998" /organism="Aspergillus subolivaceus" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.tamar 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus tamarii. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus tamarii. ORGANISM Mitochondrion Aspergillus tamarii. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29224 LOCUS APU29224 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus tamarii NRRL 20818 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29224 NID g1144028 KEYWORDS . SOURCE Aspergillus tamarii. ORGANISM Mitochondrion Aspergillus tamarii Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144028 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 20818" /organism="Aspergillus tamarii" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 474 a 211 c 287 g 402 t ORIGIN BASE COUNT 474 a 211 c 287 g 402 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUu----- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaca-- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCUA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.terri 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus terricola. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus terricola. ORGANISM Mitochondrion Aspergillus terricola. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29212 LOCUS ATU29212 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus terricola NRRL 426 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29212 NID g1144016 KEYWORDS . SOURCE Aspergillus terricola. ORGANISM Mitochondrion Aspergillus terricola Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144016 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 426" /organism="Aspergillus terricola" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 474 a 211 c 287 g 402 t ORIGIN BASE COUNT 474 a 211 c 287 g 402 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUu----- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaca-- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCUA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.A.thomi 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Aspergillus thomii. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Aspergillus thomii. ORGANISM Mitochondrion Aspergillus thomii. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U29217 LOCUS ATU29217 1374 bp DNA PLN 02-JAN-1996 DEFINITION Aspergillus thomii NRRL 2097 mitochondrial ribosomal RNA, small subunit, mitochondrial gene, partial sequence. ACCESSION U29217 NID g1144021 KEYWORDS . SOURCE Aspergillus thomii. ORGANISM Mitochondrion Aspergillus thomii Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus. REFERENCE 1 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Phylogenetic analysis of Aspergillus based upon rDNA sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 1374) AUTHORS Peterson,S.W. TITLE Direct Submission JOURNAL Submitted (15-JUN-1995) Stephen W. Peterson, National Center for Agricultural Utilization Research, Microbial Properties Research, 1815 N. University St., Peoria, IL 61604, USA COMMENT NCBI gi: 1144021 FEATURES Location/Qualifiers source 1..1374 /strain="NRRL 2097" /organism="Aspergillus thomii" /mitochondrion rRNA <1..>1374 /product="small subunit ribosomal RNA" BASE COUNT 475 a 210 c 288 g 401 t ORIGIN BASE COUNT 475 a 210 c 288 g 401 t 3839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------~~~ ~~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~G AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---uuaaua- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa--)----- --------UC CCUUauaa-- ---------- 1081 ---------- ---------- ---------- ---------- -----ac--g aaaggaaaau 1141 aaaag-ucc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUCU-UU |a------uc uCGG--GG-- 1321 -AGUAGUAGG AA-AG(GUAA UGA------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCUAAa---A U|CCGUA-GU CG|--UGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( auua-)---- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GCUGA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUAA --GUGU-AUU (--------a u--ugu---- 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucguau aaaauucuaa 1801 auaggauaau gauaaugaca auuuccuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAAU---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAGU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -Uu-AUgu-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGGG(a 2341 ugaaa)UAC- uuu---GAUA CCAG-AAG-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAUAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UGA 2521 U--GAAU-GU |CA|UAGGCU AGAuuu(aaa a-u------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-----U UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUAACCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUuugaa uaacaauaaa a--------- 2881 ---------u ug--u----- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------u a--c---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 ACU)CCUC-- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(aaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----c auaaagugGU -UCGCCA-C- (UACA-U)-- UGGaccAGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCuu a-ACAA-AGG GA--UGCGA- 3901 UAUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UGA--)AAUG -GAGCUAAUC CCCA--aaau uGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--A-AU 4261 CUCAGC-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GGAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< -uaaguuuga 4381 uuugc-uuau guauuaauau auauaa(uca g)guauauaa auauguaagu auuauuuucg 4441 ua-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AU~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~- ~~~~~~~~~~ -----~~~-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.E.nid.2 5213 bp RNA RNA 09-MAY-1996 DEFINITION Mitochondrion Emericella nidulans.; ATPase; cytochrome; cytochrome oxidase; oxidase; transfer RNA; transfer RNA-Ala; transfer RNA-Arg; transfer RNA-Asn; transfer RNA-Asp; transfer RNA-Gln; transfer RNA-Glu; transfer RNA-Gly; transfer RNA-His; transfer RNA-Ile; transfer RNA-Leu; transfer RNA-Lys; transfer RNA-Met; transfer RNA-Phe; transfer RNA-Pro; transfer RNA-Ser; transfer RNA-Thr; transfer RNA-Trp; transfer RNA-Tyr; transfer RNA-Val; unidentified reading frame. ACCESSION J01390 KEYWORDS ATPase; cytochrome; cytochrome oxidase; oxidase; transfer RNA; transfer RNA-Ala; transfer RNA-Arg; transfer RNA-Asn; transfer RNA-Asp; transfer RNA-Gln; transfer RNA-Glu; transfer RNA-Gly; transfer RNA-His; transfer RNA-Ile; transfer RNA-Leu; transfer RNA-Lys; transfer RNA-Met; transfer RNA-Phe; transfer RNA-Pro; transfer RNA-Ser; transfer RNA-Thr; transfer RNA-Trp; transfer RNA-Tyr; transfer RNA-Val; unidentified reading frame. SOURCE Mitochondrion Emericella nidulans. ORGANISM Mitochondrion Emericella nidulans. REFERENCE 1 (bases 5833 to 7155; 11536 to 12832) AUTHORS Kochel,H.G., Lazarus,C.M., Basak,N. and Kuntzel,H. TITLE Mitochondrial tRNA gene clusters in Aspergillus nidulans: organization and nucleotide sequence JOURNAL Cell 23 (2), 625-633 (1981) STANDARD No information REFERENCE 2 (bases 2205 to 4121) AUTHORS Kochel,H.G. and Kuntzel,H. TITLE Nucleotide sequence of the Aspergillus nidulans mitochondrial gene coding for the small ribosomal subunit RNA: homology to E. coli 16S rRNA JOURNAL Nucleic Acids Res. 9 (21), 5689-5696 (1981) STANDARD No information REFERENCE 3 (bases 1 to 2600; 3901 to 6000; 6901 to 11800; 12605 to AUTHORS Netzker,R., Kochel,H.G., Basak,N. and Kuntzel,H. TITLE Nucleotide sequence of Aspergillus nidulans mitochondrial genes coding for ATPase subunit 6, cytochrome oxidase subunit 3, seven unidentified proteins, four tRNAs and L-rRNA JOURNAL Nucleic Acids Res. 10 (15), 4783-4794 (1982) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: J01390, V00653 14440) [2] compares given sequence with that of E.coli 16S rRNA. [3]: one of the unidentified polypeptides (urf's) is located in the intron of the l-rRNA gene & codes for a basic protein of 410 residues. The other urf's are in spacer regions & code for hydrophobic proteins. Urf-a is homologous to human urf4, and urf-b produces a polypeptide of 48 residues resembling the human urf6l product (hydrophobic N-terminus, basic C-terminus). The ATPase subunit 6 genes from mitochondria and E.coli appear to share a common ancestor. The codon frequencies of identified genes and urf's are similar, and codons ending with G or C are rarely used. For partial sequence of A.nidulans mt apocytochrome b gene that lies within H2 region see <animtcyb1>, <animtcyb2>. s-rRNA = small ribosomal subunit RNA; l-rRNA = large ribosomal subunit RNA. BASE COUNT 500 a 208 c 300 g 429 t 3776 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------aaa auuuuGAGUU 661 (UGA-)U-GA U|GGCUC-UG AUUGAACGCU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUU------ ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---auua--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- AACUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-UUug --GC---UAC CUUAA-AGUA 1021 AGGGG----- -------(aa aa-a)----- --------UC CCUUAUA--- ---------- 1081 ---------- ---------- ---------- ---------- -----AAAAG AAAGGAaaaa 1141 gaagg-UCC- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUGUU- --AAUUA-UU |a------uC ACGG--UG-- 1321 -AGUAGUAGU AA-AG(GUAA uga------- ---------- ---------- ------)CUU 1381 UACUA|---- GCUAA----A U|CCGUA-GU CG|--uGACU (GAGA--)GG UCGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)ACCCCA A|UGCgu--( uu-u-)--a- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)G GC-GA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGAAA --GUGU-AUU (--------a uaau------ 1621 --------)A AUACAAUAAC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )auaucguau aaaauucuaa 1801 auagaauaau gauaaugaca auuuucuauu ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----UAUAA GUCUU|-GAC 1921 -CAAaC---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAG|--- -AAG-ACU-- 1981 AGUGU-UAAU CAU--CUUUA UUAGGU|UUA AAGGGUACCU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGU ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UAUUUAC-UA 2281 G-----AGUU -UU-AUgu-a -AGAAG--GA -----|AGAA GCUCUG-GAG ---UAGUG(A 2341 UAUAA)UAC- GUA---UAUA CCAG-AGA-G ACU------- ----GGUAAC -GGC(-GAAG 2401 -)GC|A---- ----UCCUUC U-AUGUAAA- AA---CUGAC GUU--GAGGG ACGAA-GGCU 2461 U-GGG---UA GCAAGAAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGACAA-UGA 2521 U--GAAU-GU |CA|UAGACU AGAaaa(agu cguuuagacu au-------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)aaa-UU UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAU-U 2761 AG|ACCGUU- UCUGAG---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUGAUCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGUUUGAA Uau------- ---------- 2881 (--------u u--)------ ---------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->-------u a--C---AAG CGC-UG|CA- 3121 |CG|-GC--U |G------UU UU-UA|G-UU AAU-|GUC(G --UGA)GAUC U--GG(UUA- 3181 AGU)CCU-U- U-AAUUAACG AAA-ACCCU- ----cacuuu auuug----- -----(cauu 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auaaaguuGA -UCGCCU-U- (UAUA-U)-- UGGuu-AGAU 3781 A----AUA-G GGAUUA-AGA C-AAGUCAUC A|UGGC|CUU AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--UGCCUU U-ACAA-AGG GA--UGCGA- 3901 UUUU<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--G UG---)AAAu uGAGCUAAUC CCCC-AAAAA AGG-AUAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAUC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUA--A-AA 4261 AUCAGC-UG- GGUACUAA-C -CACUCGUCA G-GCG--CUG AAA-GAAgua ugugcaa--- 4321 ---------- ---------- ---------- ---------- ---------< gaaguuugau 4381 uuacu-uaua uuuauaauau auauaa(uca g)uuauauau auuuauaagu uaaauuuucg 4441 ca-------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-U AAGUCGAAAU AUGGUUCG-U GUA-AU(GGA 4621 -A)AUU-GC- ACGGGAUGAA -----UUA-| ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS mt.P.chr.1 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Penicillium chrysogenum. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Penicillium chrysogenum. ORGANISM Mitochondrion Penicillium chrysogenum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: L01493 DEFINITION Penicillium chrysogenum mitochondrial ribosomal RNA small subunit gene. SOURCE Mitochondrion Penicillium chrysogenum (organelle Mitochondrion Penicillium chrysogenum) (library: KCTC 1262) DNA. ORGANISM Mitochondrion Penicillium chrysogenum Eukaryota; Fungi; Ascomycota; Plectomycetes; Eurotiales; Trichocomaceae. REFERENCE 1 (bases 1 to 1482) AUTHORS Kochel,H. and Kuntzel,H. TITLE Nucleotide sequence of the Aspergillus nidulans mitochondrial gene coding for the small ribosomal subunit RNA: homology to E.coli 16S rRNA JOURNAL Nucleic Acids Res. 9, 5689-5696 (1981) REFERENCE 2 (bases 1 to 1482) AUTHORS Sekiguchi,J., Ohsaki,T., Yamamoto,H. and Koichi,K. TITLE Characterization and comparison of mitochondrial DNAs and rRNAs from Penicillium urticae and P.chrysogenum JOURNAL J. Gen. Microbiol. 136, 535-543 (1990) REFERENCE 3 (bases 1 to 1482) AUTHORS Sheen,J. TITLE Characterization and comparison of mitochondrial DNAs and RNAs from Penicillium urticae and P.chrysogenum JOURNAL Unpublished (1992) FEATURES Location/Qualifiers rRNA 95..>1482 /product="ribosomal RNA small subunit" source 1..1482 /organism="Mitochondrion Penicillium chrysogenum" /organelle="Mitochondrion Penicillium chrysogenum" /tissue_lib="KCTC 1262" /sequenced_mol="DNA" BASE COUNT 467 a 222 c 289 g 410 t 3825 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------aaa auagaGAGUU 661 (UGA-)ucga u|GGCUC-UA ACUGAACACU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUuaau-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------uauu ---------- 841 aucu------ ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- --aauauuua AAUUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA--aG A|UAA--Uug --gc---UAC Cuuaa-cguA 1021 AGGGa----- -------(aa au-a)----- --------gC CCUUAUG--- ---------- 1081 ---------- ---------- ---------- ---------- -------acc caa-gu--ua 1141 auauu-acc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UA-GAUgau- --AUUUA-UC |--------- uCGG--UG-- 1321 -AGUAGUAGG AA-GG(-ua- uga------- ---------- ---------- ------)CUU 1381 U-CUA|---- GCA------- -|-------- --|--uAACU (AGGAA-)AG UUGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)AACCCA A|UGCuu--( uu-a-)--u- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ---GAAAC)G GU-GA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUCU --AUGU-AAC (--u------ uguau----- 1621 -------g)G UUACAuucgC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucgcau aaaauucuaa 1801 auagauugua uauaaugac- auauc-uau- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ----uUAUAA GUCU-|-GAC 1921 cCAAaC---U ACGU-G(-CC AGCAGUC-CG -GGU-AA)-U ACGUAG|--- -GAG-GCU-- 1981 AGUGU-UAGU UAU--CUUUA UUGGGU|UUA AAGGGUAAGU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaac)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -AU-AUga-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGAG(A 2341 UAAAA)UUUc gau-c-GAUA CCAG-GAG-G ACU------- ----GUCAAC -GGC(-GAAG 2401 -)GG|C---- ----UCCUUC U-AUGUAAU- AA---CUGAC GUU--GAGAG ACGAA-GGCU 2461 U-GG----UA GCAAACAGG( AUUAGAUAC) CCcuaAUAG| -UCCA-AGC- AGACAA-UGA 2521 U--GAAU-GU |CA|UACAUU AGAuau(aau ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----UU UAAUGUA-UA AAC(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UACUAUG(-- -GCAA--)CA UAU---AACU GAA-UCAU-U 2761 AG|ACCGUU- -CUA-----A CCAGUAGU|G AA-------- |--------U CG(AUGAUCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGCUUGUA Uagca----- ---------- 2881 ---ua---uu au-aaaa--- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->aau-uguu a--c--aAGC CGC-UG|CA- 3121 |UG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 AUU)CCU-U- U-AAUUAACG AAA-ACCCU- ----cacuuu auuua----- -----(uuua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auaaaguggu cgcacaa-c- -ggaccagau aaucagggau 3781 g----cuA-G GGAUUA-AGA C-AAGUCAUU A|UGGC|CUU AAU------- ---------G 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCUU U-acaa-cgg ga--ugcga- 3901 uauu<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--g uga--)aaug -gagcuaauc ccc--aaaAA AGG-AAAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAA- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAAC-- --)GUCACGG U-GCA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- auuu--U-AU 4261 CUUAGU-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG Aaaaaaagaa gaugcag--- 4321 ---------- ---------- ---------- ---------- ---------< uaaguuugau 4381 uuuuu-ucug uguaa-guua uauauauuua u(-gau-)au auaaauaugc cacggauagu 4441 uu-cg-a-gc aaacuugacg ca-------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 -------ugc augacUUUGA UUGG-UGU-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.chr.2 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Penicillium chrysogenum. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Penicillium chrysogenum. ORGANISM Mitochondrion Penicillium chrysogenum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z23072, L01493 DEFINITION P.chrysogenum mitochondrion genes for tRNA-Arg, tRNA-Asn, tRNA-Tyr, small subunit rRNA, and ATPase subunit 6 SOURCE Penicillium chrysogenum ORGANISM Mitochondrion Penicillium chrysogenum Eukaryota; Plantae; Thallobionta; Eumycota; Ascomycotina; Plectomycetes; Eurotiales; Trichocomaceae. REFERENCE 1 (bases 1 to 4785) AUTHORS Kochel,H. and Kuntzel,H. TITLE Nucleotide sequence of the Aspergillus nidulans mitochondrial gene coding for the small ribosomal subunit RNA: homology to E.coli 16S rRNA JOURNAL Nucleic Acids Res. 9, 5689-5696 (1981) REFERENCE 2 (bases 1 to 4785) AUTHORS Sheen,J., Kim,S., Kho,Y.H. and Bae,K.S. TITLE Genomic DNA sequences of mitochondrial tRNA genes in fungi Penicillium chrysogenum KCTC1262:tRNA-arg, tRNA-asn, and tRNA-tyr genes JOURNAL Nucleic Acids Res. 20, 5842-5842 (1992) REFERENCE 3 (bases 1 to 4785) AUTHORS Sheen,J. TITLE Genomic sequence of mitochondrial DNA: Genes for tRNA-arg,tRNA-asn, tRNA-tyr,ATPase subunit 6,and SSU-rRNA gene in Penicillium chrysogenum JOURNAL Unpublished REFERENCE 4 (bases 1 to 4785) AUTHORS Sheen,J. TITLE Direct Submission JOURNAL Submitted (18-JUN-1993) Sheen J., Genetic Engineering Research Institute, K.I.S.T., Korean Collection for Type Cultures, Taeduck Science Town, Yuseong-gu, Taejeon, Republic of Korea, 305-606 FEATURES Location/Qualifiers source 1..4785 /organism="Penicillium chrysogenum" /mitochondrion /strain="KCTC 1262" /clone="pSR-H2" tRNA 729..798 /function="transfer RNA for amino acid arginine" /product="tRNA-Arg" /gene="tRNA-Arg" /anticodon=(pos:761..763,aa:Arg) /citation=([2],[3]) /note="Arg-tRNA gene, identified by the cloverleaf structure of its putative transcript and assigned to the amino acid arginine by its anticodon sequence UCU" tRNA 832..902 /function="transfer RNA for amino acid asparagine" /product="tRNA-Asn" /gene="tRNA-Asn" /anticodon=(pos:864..866,aa:Asn) /citation=([2],[3]) /note="Asn-tRNA gene, identified by the cloverleaf structure of its putative transcript and assigned to the amino acid asparagine by its anticodon sequence GUU" rRNA 2413..3861 /function="mitochondrial ribosome formation" /product="small subunit rRNA" /gene="s-rrna" /standard_name="SSU-rRNA" /citation=[3] /note="The coding region of SSU rRNA gene is defined by extensive homology with mitochondrial SSU rRNA of Aspergillus nidulans" tRNA 3960..4044 /function="transfer RNA for amino acid tyrosine" /product="tRNA-Tyr" /gene="tRNA-Tyr" /anticodon=(pos:3995..3997,aa:Tyr) /citation=([2],[3]) /note="Tyr-tRNA gene, identified by the cloverleaf structure of its putative transcript and assigned to the amino acid tyrosine by its anticodon sequence GUA" CDS 1258..2031 /function="Oxidative phosphorylation" /standard_name="ATPase 6" /citation=[3] /note="The coding region of ATPase subunit 6 gene is defined by extensive homology(about 84%) with ATPase subunit 6 of A.nidulans" /product="ATPase subunit 6" /codon_start=1 /translation="MRHLDFVLSPLDQFEVRDLFSLNANLLGNLHLSLTNIGLYLTIS IFLILTYSLLATNNNKIIPNNWSISQESIYATVHGIVVNQINPNKGQMFFPLMYVLFI FILVNNLIGLVPYSFASTSHFILTFSISFTVVLGATILGFQRHGLKFFSLFVPSGCPL ALLPLLVLIEFISYLSRNVSLGLRLAANILSGHMLLSILSGFTYNIMTSGIIFFILGL IPLAFIIAFSGLELAIAFIQAQVFVVLACSYIKDGLDLH" BASE COUNT 503 a 212 c 298 g 436 t 3764 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------aaa auagaGAGUU 661 (UGA-)U-GA U|GGCUC-UA ACUGAACACU -G-UCCA-AG |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGACU|AAUU AGUUuaau-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------uauu ---------- 841 aucu------ ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- --aauauuua AAUUAAGU|A 961 G--UA-GU|G GUGUACAGGU GAGUAA-aaG A|UAA-AUug --gc---UAC CUUAA-AGUA 1021 AGGGa----- -------(aa aa-a)----- --------uC CCUUAUA--- ---------- 1081 ---------- ---------- ---------- ---------- -------acc aaaggu--ua 1141 auauu-acc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAUgau- -aAUUUA-UC |--------- uCGG--UG-- 1321 -AGUAGUAGG AA-GG(-uaa uga------- ---------- ---------- ------)CUU 1381 UUCUA|---- GCAau---aa a|CCGUA-GU CG|--uAACU (GGAA--)AG UUGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)AACCCA A|UGCuu--( uu-a-)--u- GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----GAAA)C GU-GA-ACC| 1561 A|-GUAA-C- UU-GGA---- -AGAAUGUCU --AUGU-AAC (--u------ uguau----- 1621 -------g)G UUACAuucgC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )aacucgcau aaaauucuaa 1801 auagauugua uauaaugac- auaaucuau- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ----uUAUAA GUCUU|-GAC 1921 -CAAaC---U ACGU-G(-CC AGCAGUC-GC -G-U-AA)-U ACGUAG|--- -GAG-GCU-- 1981 AGUGU-UAGU UAU--CUUUA UUGGGU|UUA AAGGGUAAGU -A-GACG|GU AAAUUA--AA 2041 |CUC------ ---------- -------(-- --uaaac)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GAGu ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|U UUUUUAC-UA 2281 G-----AGUU -AU-AUga-g -AGAAG--GA -----|AGAA UUUCUG-GAG ---UAGAG(A 2341 UAAAA)UUU- GAU---GAUA CCAG-GAG-G ACU------- ----GUCAAC -GGC(-GAAG 2401 -)GC|G---- ----UCCUUC U-AUGUAAU- AA---CUGAC GUU--GAGAG ACGAA-GGCU 2461 U-GGG---UA GCAAACAGG( AUUAGAUAC) CCUA-AUAG| -UCCA-AGC- AGACAA-UGA 2521 U--GAAU-GU |CA|UACAUU AGAuau(aau ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----UU UAAUGUA-UA AAC(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UACUAUG(-- -GCAA--)CA UAU--AAACU GAAAUCAu-U 2761 AG|ACCGUU- UCUAAA---A CCAGUAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUGAUCC 2821 G--------- ----)CGAAA A-ACCUUACC ACAGCUUGUA Uagca----- ---------- 2881 ---ua---uu au-aaaa--- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- --aau-uguu a--c---AAG -GC-UG|CA- 3121 |UG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAUU U--GG(UUA- 3181 AUU)CCU-U- U-AAUUAACG AAA-ACCCU- ----cacuuu auuua----- -----(uuua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auaaaguggu -ucgcuacua cau------- cggaccagau 3781 a----auA-G GGAUUA-AGA C-AAGUCAUU A|UGGC|CUU AAU------- ---------G 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--CGCCUU U-acaa-cgg ga--ugcga- 3901 uauu------ ---------- ---------- ---------- ---------- ---------- 3961 ---------- ------(--g uga--)aaug -gagcuaauc ccc--aaaAA AGG-AAAUAA 4021 ---------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAA- -AAGGAAUUA 4141 C-U--AGUAA U-CGUGAA(- UCACCAAC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UUU--U-AU 4261 CUUAGU-UA- GGUACUAA-C -CACUCGUCA G-GCG--CUG Aaa-aaagaa gaugcag--- 4321 ---------- ---------- ---------- ---------- ---------< uaaguuugau 4381 uuuuu--cug uguaaaguua uauauauuua u(-gau-)au auaaauaugc -a-ggauagu 4441 uuucguaugc aaaa------ ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ----cUUUGA UUGG-UGU-U AAGUCGAAAU AAGGUUCG-U GUA-AU(GGA 4621 -A)AUU-GC- ACGGGGAGUA UAAAA----| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.T.rubru 5213 bp RNA RNA 11-JAN-191 DEFINITION Trichophyton rubrum. ACCESSION No information KEYWORDS No information. SOURCE Trichophyton rubrum. ORGANISM Trichophyton rubrum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X88896 LOCUS TRMITOGEN 5207 bp DNA PLN 10-OCT-1995 DEFINITION T.rubrum ND4, ATP6, SSUrRNA, ND6, COXIII, ATP8, and 6 tRNA genes. ACCESSION X88896 KEYWORDS atp6 gene; atp8 gene; coxIII gene; ND4 gene; ND6 gene; small subunit ribosomal RNA; tRNA-Asp gene; tRNA-Gly gene; tRNA-Ile gene; tRNA-Lys gene; tRNA-Trp gene; tRNA-Tyr gene. SOURCE Trichophyton rubrum. ORGANISM Mitochondrion Trichophyton rubrum Eukaryotae; mitochondrial eukaryotes; Eumycota; Ascomycotina; Plectomycetes; Onygenales; Arthrodermataceae; mitosporic Arthrodermataceae; Trichophyton. REFERENCE 1 (bases 1 to 5207) AUTHORS de Bievre,C. and Dujon,B. TITLE Organisation of the mitochondrial genome of Trichphyton rubrum JOURNAL Unpublished REFERENCE 2 (bases 1 to 5207) AUTHORS de Bievre,C. TITLE Direct Submission JOURNAL Submitted (21-JUN-1995) to the EMBL/GenBank/DDBJ databases. C. De Bievre, Institut Pasteur, 25 rue du Docteur ROUX, F75724 Paris-cedex 15, FRANCE COMMENT NCBI gi: 1017446 FEATURES Location/Qualifiers source 1..5207 /organism="Trichophyton rubrum" /strain="IP.1817.89" /clone_lib="genomic library in pUC19" /clone="C1" /mitochondrion CDS <1..56 /gene="ND4" /note="pid:e200717; NCBI gi: 1017447" /codon_start=3 /transl_table=4 /translation="AVILDGLHYSVSGLIYN" CDS 359..1126 /gene="ATP6" /note="pid:e204052; NCBI gi: 1017448" /codon_start=1 /transl_table=4 /translation="MMFNNIISPLEQFEIKDLFSLNINIINLKMSLTNFGFYIIISTI IILTLHLLITYNNKLISNSWTLTKESIYATVHSVVINQINSKEGQNYFPFIYGLFIFI LMNNLLGLIPYSFSSTSHFILTFFISFTVVLGATILGFQKHQLKFFSLFVPSGCPLGL LPLLVLIELISYLARNVSLGLRLSANILSGHMLLVILSDFTFKIMSSGIFYFLIGLIP LAFIFAFSGLELGIAFIQSQVFIVLTCSYIRDSLELH" rRNA 1421..2824 /product="small subunit ribosomal RNA" tRNA 2870..2944 /gene="tRNA-Tyr" /product="tRNA-Tyrosine" CDS 3022..3633 /gene="ND6" /note="pid:e204053; NCBI gi: 1017449" /codon_start=1 /transl_table=4 /translation="MQLDLYVDKINNGFNSNILDILAFISIILGIYTIVSKNPVVSVL FLIGLFSTISIYLIMIGLTFIGLSYLLVYIGAVSILFLFILMLINIRISELVSTNNNY IPLAILSMITLVYILGQKIITNVVQFNILNSFTSSLFEKSFKESINYSNSLSWDTNLI DITHTSAIGNIMYSSYSFWLIIISLILLLAMVGSIVISIGRVI" CDS 3657..4466 /gene="COXIII" /note="pid:e204054; NCBI gi: 1017450" /codon_start=1 /transl_table=4 /translation="MSLYQRTNFQSHPYHLVWPSPWPFYNSLSLFILTTSGVLTMHGF SNMYIILFIAFINLVWCMTLWFRDIISEGTYLGNHTNAVQRGLNLGVGLFIASEALFF LAIFWTFFHSSLSPNVELGAQWPPLGIKAIDPFELPLLNNIILLSSGVTVNSNYHSLI QGNRKGALYGLVATILLAIVFTIFQGIEYSVSSFTISDGVYGSCFYFSTGFHGFHVLI GTAFLSVGLWRLLGYHLTDHHHLGYESGILYWHFVDVVWLILYVCIYFWGY" CDS 4540..4686 /gene="ATP8" /note="pid:e204055; NCBI gi: 1017451" /codon_start=1 /transl_table=4 /translation="MPQLIPFFFFNQVVFTLISLSFIFFVFSKYILPWIVRLYVSRNQ YNSL" tRNA 4704..4774 /gene="tRNA-Lys" /product="tRNA-Lysine" tRNA 4779..4848 /gene="tRNA-Gly2" /product="tRNA-glycine" tRNA 4857..4927 /gene="tRNA-Asp" /product="tRNA-Aspartate" tRNA 5021..5092 /gene="tRNA-Ile" /product="tRNA-Isoleucine" tRNA 5096..5165 /gene="tRNA-Trp" /product="tRNA-Tryptophan" BASE COUNT 1932 a 588 c 712 g 1975 t ORIGIN BASE COUNT 532 a 192 c 245 g 435 t 3809 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ------auaa auuuuGAGUU 661 (UGA-)U-GA U|GGCUC-UG ACUGAACGCU -A-UCCA-AG |UG-CU--UA ACAC-A-UGC 721 -UAAUCG-UA Cguca|uua- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --aauaaaaa 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ----uaau|g 961 a---a-GU|G GUAAACAGGU GAGUAU-aua a-uau-uuu- -gac---uAC CUUAA-AGAA 1021 AGGu------ -------(ua aa-u)----- ---------c CCUUAUA--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---auc(aaa 1141 -----)gaa- ---------- -aa(uucu)u uc-------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGauguu- aauaaauauu |--------- uCGGUUUG-- 1321 -UAAUAauua a----(AUAA UAA------- ---------- ---------- ------)--- 1381 auaa-|---- UUAAC--aaa a|CCGUA-GU CG|--UAACU (GAGA--)AG UUGAUCGAC| 1441 CACAUU-AGG AA(UGAGA-- AA-)CUCCUA A|ugcg---( cuuua)---a gua----C-A 1501 GCA|GUG-AG GGAUAUUGGU C-AAUGACC( ---------- ----UAAC)G GUUGA-ACC| 1561 A|-GCAA-C- UU-GGA---- -agaaugcaa --ugua-uua (--------a aaauau---- 1621 --------)u aauac----- -aau-uaacg uguaaacgua uaaaauucua aauagauuaa 1681 agauaa---- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ugacaauuau cuauuuauua GUCUC|-GAC 1921 -CAA-Ua-cU ACGU-G(-CC AGC-GUC-GC --GU-AA)-G ACGUAA|--- -GAG-ACA-- 1981 AGUGU-AAGU CAU--cuuaa uuaGGU|UUA AAGUGUACAU -A-GACG|-a aaaaua-aa- 2041 -ccuuaaaaa gggua----c u--------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- uuuuuuc-UA 2281 G-----AGUU -UU-AU--aa aagaag--aa u----|UGAA UUUUUG-AAG ---AAAAG(A 2341 UAGAA)UUU- GCA---AAUA ACAA-AAA-G ACA------- ----GGUAGC -AGU(-UAAU 2401 -)AC|G---- ----accuuc u-UUAUAAA- AA---CUGAC GUU--GAGGU ACGAA-GGCU 2461 U-GGG---UA ACGAGCAGG( AUUAGAUAC) CCUA-GUAG| -UCCA-AGC- AGAAAA-UUC 2521 U--GAAU-GU |CA|UAAAuu ------(-aa aaa------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ -acUUUA-UA AAU(AAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UACAAUG(-- -GCAA--)CA UUA--AAACU GAAAUCAU-U 2761 AG|GCCGUC- UUUGAA---A CCAGUAGU|G AAGUAUGU-U |AUUUA--UU CG(AUAACCC 2821 G--------- ----)CGAUU A-AUCUUACC ACAAUUUGAA uaauau---- ---------- 2881 --uua---au u--------- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ----a-uauu a--C---AUG CGC-UG|CA- 3121 |CG|-GC--U |G------UC UU-UA|G-UU AAU-|GUC(G --UGA)GAU- -uagg(uua- 3181 auu)ccu-a- c-aAUUAGCG AAA-ACCUug -----guau- uau------- -----(---- 3241 --)<-uua-- ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u auguauaaua uaccuug-cc (acua-g)au cggaauauau 3781 a-----uauA GGAUCA-AGA C-AAGUCAUC A|UGGC|CAA AAU------- ---------A 3841 U-U-GU-GGG CU-AUA--GA -CGUGCCACA UU--uuccau u-acaa-aag ga--uguua- 3901 uauu------ ---------- ---------- ---------- ---------- ---------- 3961 ---------- ------(--G UGA--)aaau a-agcuaauc cu----uaaa uuu-guac-- 4021 -aa------- -----UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAc-uc) G-AC-U--AC -A--UGAAU- -AAGGAAUUA 4141 C-U--AGUAA U-CGUUAA(- UCAUC-AC-- --)GUAACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAG--uuua 4261 cUCAAU-uaa GGUACUAA-C -CACUCGAAA G-GCG--CUG AAA-gaagaa a--------- 4321 ---------- ---------- ---------- ---------- ---------< ------ugca 4381 auaag-uuug auuugugaau auaaauaaau aua(uaaa)u aguuauaauu uuauauucau 4441 auuauuuucg aauguauaa- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ----cuuuaa UUGG-UGU-U AAGUCGAAAU AAGGUUCG-U GUA-AU(GGA 4621 -A)AUU-GC- ACGGG----- ---------| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (7)-PYRENO 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.C.paras 5213 bp RNA RNA 12-NOV-1997 DEFINITION Mitochondrion Cryphonectria parasitica.; . ACCESSION AF029891 KEYWORDS . SOURCE Mitochondrion Cryphonectria parasitica. ORGANISM Mitochondrion Cryphonectria parasitica. REFERENCE 1 (bases 1 to 11565) AUTHORS Searles,D.B., Monteiro-Vitorello,C.B. and Bertrand,H. TITLE The mitochondrial small subunit ribosomal RNA gene of Cryphonectria parasitica is large and contains four introns JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 11565) AUTHORS Searles,D.B., Monteiro-Vitorello,C.B. and Bertrand,H. TITLE Direct Submission JOURNAL Submitted (13-OCT-1997) Microbiology, Michigan State University, East Lansing, MI 48824, USA STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: AF029891 BASE COUNT 564 a 258 c 388 g 554 t 3449 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- guuauauuua uagguGAGUU 661 (UGG-)U-GA U|GGCUC-UG AUUGAACGCU -G-UCCA-AA |UG-CU--UG ACAC-A-UGC 721 -UAAUCG-UA CGuuu|aau- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------uua uagcuuuuca 841 uauauuagua uuugagcccc auuauuuuuc guaguggugu aauauauuau uccuucgggu 901 ccuuccguaa ggaaggaccc -cuaagguaa caauauauug aagguuu--- ----auua|a 961 a---A-GU|G GUGUACAGGU GAGUGU--aA G|AUA-UUcg -gcc---GAC CUUGA-AGAG 1021 AGGgaaaa-- -------(ga aa-u)----- ---------a CCUCAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --------aa uaaaau(agu 1141 u----)auuu aaua------ ---(----)- -----gcuau auuu(ggau) aaagggugua 1201 aaacc----- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGAggaa- aaGGUAU-CU |--------g uCGGGAUA-- 1321 -GGUAGUAGU UA-AG(GUAA UGG------- ---------- ---------- ------)CUU 1381 AACUA|---- GCCAAUAAUU C|UCGGA-GU CG|--AAGCU (GAAAU-)GG UUGAUCGAC| 1441 CACAUU-GGG AA(UGAAA-- AA-)AUCCCA A|GGCA---( ua-au)---U GUA----C-A 1501 GCA|GUG-AG GAAUUUUGGU C-AAUGCGC( ---------- ----UAAC)G GCUGA-ACU| 1561 G|-GCAA-C- UU-GGA---- -ugaacggac -cgacucuua -----cccaa agguugcauu 1621 auuauuauuu uu-------- ---------- ---------- ---------- ---------- 1681 auguaacuag uaggguaaug gugcaggaga ucuuuuuuag gaguaaaguu cuaaauauau 1741 gauugauaa- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ugacaauaua uaua-u-uaU GUCCU|-GAC 1921 -CAA-U---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAU|--- -GGG-ACU-- 1981 AGUGU-UAUU CAU--cuuaa auaGGU|UUA AAGGGUUCCU -A-GACG|GC UAAUgc-ca- 2041 -ccuuuaaaa gguaa----c u--------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- AGUUAGC-UA 2281 G-----AGUU -UU-AU--gu gAAGAG--GU -----|CGUA CUUUUGaGUG ---GAGAG(U 2341 UUAAA)UUC- UUU---GAUA CCUG-GAG-G ACG------- ----GAUAAA -GGC(-GAAG 2401 -)GC|A---- ----ACCUCU U-AUGUAAA- AA---CUGAC GUU--GAGGA ACGAA-GGCA 2461 uugcg---UC ACGAAAAGG( ACUAGGGAC) CCUA-GUAG| -ucuu-UGC- AGAAAA-UgA 2521 U--GAGU-GC |CA|UAGAUU agg---(-uu aauu------ ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----cu uAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-C|--C|AC C-UCAA-GAG UAAUGCG(-- -GCAA--)CG CAG--GAACU GAAAUCAC-U 2761 AG|ACCGUU- UCUGAC---A CCAGCAGU|G AAGUAUGU+U |GUUUAA-UU CG(AUGACCC 2821 A--------- ----)CGAAA A-AUCUUACC ACAAUUUGAA ua-gaauaa- ---------- 2881 ---------- ---------- ---------- ---------- --aguaauua aaacuccauc 2941 uaaauuuccu uuuuuuuuuu gaauauuaag uauaauuaag gugguuuauu cauaguaauu 3001 agaaagugaa uauuggaucu uugguaguuu uagguagu-- ---------- ---------- 3061 ---------- ---------- ---------- -uuau-ucau a--C---AAG UGU-UG|CA- 3121 |CG|-GC--U |G------UU UC-CA|G-UU AAU-|GUU(G --UGA)AACu guggc(a--- 3181 aaa)gcca-u ggaAUUAACG UAA-ACC-ug ----agcuu- uau------- -----(---- 3241 --)<-uugug aa-uauuuua uuuu------ ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----g aua-gagcua caucauc-ug cuaua-u)ug gauuugauaa 3781 ------ca-G GGACUA-AGA C-AAGUCAUC A|UGGC|CUU AAU------- ---------A 3841 U-U-GU-GGG CU-AAA--GA -CGUGCCACA UA--uuccuu a-acaa-aga ga--ugcga- 3901 aaua------ ---------- ---------- ---------- ---------- ---------- 3961 ---------- ------(--G CAA--)uauu g-agcuaauc ucaa-aaaag agg-auaaaa 4021 --aau----- a----UAUGG --AUUGU-AG C-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uc) G-GC-U--GC -A--UGAAU- -AAGAAAUUG 4141 C-U--AGUAA U-CGUGAA(- UCACC-AU-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAA--A-AC 4261 CUUGGA-UU- GGUACUAA-C -CACUCGUCA C-AUG--CUG AAA-Ggagua ugcgcaauaa 4321 g--------- ---------- ---------- ---------- ---------< ---------- 4381 -------uuu gcuuucuuau uuuaaaucca uag(uaa-)u gauaggauua cauuuuuuua 4441 auaggauu-- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 cuucguaugc gugauucUAA UUAG-UGU-U AAGUCGAAAU ACGGUUCG-G GUA-GU(GGA 4621 -A)GUU-GC- CCGGGGCUga uuaaccauu| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.N.crass 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Neurospora crassa str. 74-OR23-1A. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Neurospora crassa str. 74-OR23-1A. ORGANISM Mitochondrion Neurospora crassa. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: L33367,Z34001 Same as Z34001. DEFINITION Neurospora crassa (clone p19StyrB1) mitochondrial 19S ribosomal RNA gene and transfer RNA-Tyr gene, complete. mitochondrial transfer RNA; transfer RNA-Tyr. SOURCE Mitochondrion Neurospora crassa (strain 74-OR23-1A, organelle ORGANISM Mitochondrion Neurospora crassa Eukaryota; Fungi; Ascomycota; Pyrenomycetes; Sordariales; Sordariaceae. REFERENCE 1 (bases 1 to 2071) AUTHORS Chiang,C.-C., Kennell,J.C., Wanner,L.A. and Lambowitz,A.M. TITLE A mitochondrial retroplasmid integrates into mtDNA by a novel mechanism involving the synthesis of a hybrid cDNA and homologous recombination FEATURES Location/Qualifiers rRNA 1..1971 /product="19S ribosomal RNA" /note="putative" tRNA 1972..2058 /anticodon=(pos:2008..2010,aa:Tyr) /product="transfer RNA-Tyr" /note="putative" source 1..2071 /organism="Mitochondrion Neurospora crassa" /strain="74-OR23-1A" /mitochondrion="Mitochondrion Neurospora crassa" /sequenced_mol="DNA" /tissue_type="mycelium" /tissue_lib="FGSC #2489" BASE COUNT 615 a 292 c 409 g 556 t 3341 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 --gauguaau aaaaaaaauu uuuuuuaauu uuauauuaca ucaauaaaaa uagauGAGUU 661 (UGG-)U-GA U|GGCUC-UG AUUGAACACU -G-UUCA-AA |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGuuu|aauu ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------uu- --uggccuaa 841 gaaagggguu ucaucguggc uuaagcuaag ggguuuauug uggcuuaagc uaagguuuaa 901 ucuuugacuu aagcgggugu uuuaggggaa cuugugcccc uaaaaccucu u--aauua|a 961 a---A-GU|G GUGUACAGGU GAGUAU-aau a|uuu-uu-- --ucgcuuAA CUUAA-AGUG 1021 AAGg------ -------(ca aa-u)----- ---------c CUUCAUA--- ---------- 1081 ---------- ---------- ---------- ---------- -uugcaaaag gauauc(uua 1141 -----)ggca ccuguug-aa a--(----)- ----gg--gg ccua(cuua) uauuauaucc 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UAAGaggau- --gagaa-aa |-----guuu cAGAGAUA-- 1321 -GGUAGUUGU UA-AG(GUCA UGG------- ---------- ---------- ------)CUU 1381 AACAA|---- GCCAAUAAUU C|UCUUA-GU CG|--AAGCU (GAAAA-)GG CUGAUCGAC| 1441 CACAUU-GGG AA(UGAAA-- AA-)AUCCCA A|GGCA---( aa-ua)---G GUA----C-A 1501 GCA|GUG-AG GAAUCUUGGU C-AAUGGGC( ---------- ----CCAC)G CCUGA-ACU| 1561 G|-GUAA-C- UU-GGA---- -GGAAUGAGG -ggucaacuu (-----ugca aauggau--- 1621 --------)g agugau---C -GUU|agaag auccuuaguc cccuggucuu cuugacacau 1681 gagguauaua cuucuagucc auauuggggg gagacuccac gucgauu--- --uaucgagu 1741 aaaauucugu auacauauug gauaa----- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ugacaauaug uaca---uuu GUCUU|-GAC 1921 -UAA-U---U ACGU-G(-CC AGCAGUC-GC -GGC-AA)-U ACGUAA|--- -GAG-ACU-- 1981 AGUGU-UAAU CAU--cauaa auaGGU|UUA AAGGGUACUC -A-GACG|GA AAAAUu-cg- 2041 cccaaauaua gggga----c ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|a AUUUUUC-UA 2281 G-----AGUU -UU-AU--gu aAGAAG--GU -----|CGUA CUCUAGaGUG ---GAGAG(A 2341 UAAAA)UUC- ugu---GAUA CCUA-GGG-G ACG------- ----GGUAAA -GGC(-GAAG 2401 -)GC|A---- ----AUCUUU U-AUGUAAA- AA---CUGAC GUC--GAAGG ACGAA-GGCA 2461 A-AGG---GA ACAAAAAGG( AUUAGAUAC) CCCA-GUAG| -UCUU-UGC- AGACAA-UUA 2521 U--GAAU-GC |CA|UAGGUU AGAuu-(-uu u--------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)--aaUU UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-U|--C|AC C-UCAA-GAG UAAGGCG(-- -GCAA--)CG CAG--GAACU GAAAUCAC-U 2761 AG|ACCGUU- UCUGAC---A CCAGCAAU|G AAGUAUGU-U |AUUUAA-UU CG(GUGACCC 2821 A--------- ----)CGAAA A-ACCUUACC ACAAUUGAAU -auuaauaau aaugauauua 2881 uuuuu---ua ug-cuugaua uggcaagcac ucaauuuucc ccuccccgua gguuugccgc 2941 ggggggggag aaaaaagaaa aauaauggau aauauaguaa auaccauauu ccaacuauau 3001 uuaau----- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- --uau-uaau a--C---AAG UGU-UG|CA- 3121 |CG|-GC--U |G------UC UU-CA|G-UU GAU-|GUU(G --CGA)AACu -gugg(uuc- 3181 guu)cca-uG G-AAUUAACG UAA-ACCCUU -----gcuu- uau------- -----(---- 3241 --)<-uugu- --aaau---a u--------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u aua-aagcag uucaccu-u- (-uau-a)-u aggaaaugau 3781 a----AAA-G GGAUCA--GA C-AAGUCAUC A|UGGC|CUA AAU------- ---------A 3841 U-U-GU-GGG CU-AUA--GA -CGCGCCACA UU--uuccua a-acaa-aga ga--ugcaa- 3901 aaau------ ---------- ---------- ---------- ---------- ---------- 3961 ---------- ------(--G UGA--)auuu -uagcuaauc ucaa-aaaau agg-auaaaa 4021 aua------- --ua-CAAGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) GGAC-U--GC -A--UGAAU- -AAGAAAUUG 4141 C-U--AGUAA U-CGUGAA(- UCACC-AU-- --)GACACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-cc 4261 CUCGGA-UU- GGUACUAA-C -CACUCGUCA C-AUG--CUG AAA-GGAgu- ---------- 4321 ---------- ---------- ---------- ---------- ---------< --gcgugca- 4381 auaag-uuug cuuuucuauu auaaguaa-- guag-acaua uag-guuuag auguuauaau 4441 aggauccuuc guaugcgcg- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---gcucuGA UUAG-UGU-U AAGUCGAAAU ACGGUUCG-U GUA-GU(GGA 4621 -A)GUU-GC- ACGGGACUUA ucaauguug| aacaauacga uuggaua~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.ans.1 5213 bp RNA RNA ~?~???? DEFINITION Mitochondrion Podospora anserina. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Podospora anserina. ORGANISM Mitochondrion Podospora anserina. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X14734 Phylo:Mitochondria,Fungi,Podospora BASE COUNT 626 a 286 c 382 g 599 t 3320 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---uuuacuc acuuuaacca aaguuGAGUU 661 (UGG-)U-GA U|GGCUC-UG AUUGAACACU -G-UCCA-AA |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGuuu|aauu aaa--uu--- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --uuacaguu 841 gca-----gu aaaguuauuc uuuccuuucu guaaaacugg uuauuaagga gguuuaaauu 901 uaggguuuau ucuccucuau uuauaagguu aaucucucua aagggguuuu uuuaauua|a 961 a---A-GU|G GUGUACAGGU GAGUAU-uau g|guu-uuuu --guac-uac cUAAA-AGUA 1021 AAGG------ -------(ca aa-u)----- ---------C CUUUAUA--- ---------- 1081 ---------- ---------- ---------- ---------- -----guaau aaagaa-cgg 1141 ucaug-uuc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UUAGAUgaa- --gauaa-aa |a----aucu cGGGGAAA-- 1321 -GGUAGUUGU UA-AG(GUAA uug------- ---------- ---------- ------)CUU 1381 AACAA|---- GCCUAGUAUU C|UCUUA-GU CG|--AAGCU (GAGAAA)GG UUGAUCGAC| 1441 CACAUU-GGG GA(UGAAA-- AA-)AUCCCA A|GGCaa--( ac-g-)--aa GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----UAAC)G GCUGA-ACU| 1561 G|-GUAA-C- UU-GGA---- -AGAAUG--- ---GCU-CCA (--u-----a aaa------- 1621 -------a)u ggaguuaauC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )uau-cgaau aaaauucugu 1801 auacauaccu -auaaugacg guau-guac- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----AUCUU GUCUU|-GAC 1921 -CAA-U---U GCGU-G(-CC AGCAGUC-GC -GGC-AA)-U ACGUAA|--- -GAG-ACU-- 1981 AGUGU-UAUU CAU--CUUAA AUAGGU|UUA AAGGGUACUU -A-GACG|GU AGAAUu--ug 2041 |CCU------ ---------- -------(-- ---uaac)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GGGa ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|A AUUUUAC-UA 2281 G-----AGUU -UU-AUau-a -AGAAG--AU c----|uuac ucuaga-GUG ---UAGAG(U 2341 UGUAA)UUC- AUU---AAUA Ccua-ggg-G ACU------- ----GGUAAA -GGC(-GAAG 2401 -)GC|A---- ----AUCUUU U-AUAUAAA- AA---CUGAC GUU--GAAGG ACGAA-GGCU 2461 U-AGG---UC ACAAAAAGG( AUUAGAUAC) CCAA-GUAG| -UCUU-AGC- AGUCAA-UUA 2521 U--GAAU-GC |CA|UAGGUU AGAu--(aua guuaaauaca aacaagggcg uaagcucgua 2581 uuaaauuuua cc-------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)---aUC UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-U|--C|AC C-UCAA-GAG UAAUGUG(-- -GCAA--)CG CAG--GAACU GAAAUCAC-U 2761 AG|ACCGUU- UCUGAC---A CCAGCAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUGACCC 2821 A--------- ----)CGAAA A-ACCUUACC ACAACUUGAA u--------- ---------- 2881 ---------- ---------- ---------- --------------- ---C---AAG UGU-UG|CA- 3121 |CG|-GC--U |G------UC UU-CA|G-UU GAU-|GUU(G --UGA)AACu g-ugg(uuc- 3181 ggu)ccau-G G-AAUUAACG AAA-ACCCUU -----gcuuu auuugua--- -----(aauu 3241 c-)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-ua-aa aua-aagcag uucaccu-g- (-uau-a)-u ggguuaugau 3781 a----AAA-G GGAUCA-AGA C-AAGUCCUC A|UGGC|CUU GAU------- ---------G 3841 U-U-GU-GGG CU-AUA--GA -CGUGCCACA UG--uaccua a-acaa-aga ga--ugcaa- 3901 aaau<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--g uga--)auuu -uagcuaauc uccc-aaaau aggauaaaau 4021 -ua------- --ga-UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uc) G-GC-U--AU -A--UGAAU- -AAGAAAUUG 4141 C-U--AGUAA U-CGUGGA(- UCACCAU--- --)GACACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--A-AC 4261 UUCGGA-UU- GGUACUAA-C -CACUCGUCA C-AUG--CUG AAA-GGAgu- ---------- 4321 ---------- ---------- ---------- ---------- ---------< augcgcaaua 4381 aguuu-gcug uucuguauua aacaagaaua gaugacg(-g ug)caagcua gauuuuauuu 4441 uuuaauaugg ggcucuucgu augugug--- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---acUCUGA UUAG-UGU-A AAGUCGAAAU ACGGUUCG-U GUA-GU(GGA 4621 -A)GUU-GC- ACGGGACUUA -----UUA-| UACUUAACAA UAAAAAUUUU UAUGAAAAUC 4681 CUCAAAUCAA AUUUUGAUUG AUUUUUAUAU AUAUAUAGGA AUAUAUUCUA AAUAUCACUU 4741 GUUAUAUUUA UUAUAUACUA UAUA|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.ans.2 5213 bp RNA RNA 05-SEP-1995 DEFINITION Mitochondrion Podospora anserina.; 16S ribosomal RNA homologue; 23S ribosomal RNA homologue; ATPase 6; ATPase 8; COI gene; COII gene; COIII gene; complete genome; cytb gene; cytochrome c oxidase subunit I; cytochrome c oxidase subunit II; cytochrome c oxidase subunit III; cytochrome oxidase b apoprotein; NADH-ubiquinone oxidoreductase subunit 1; NADH-ubiquinone oxidoreductase subunit 2; NADH-ubiquinone oxidoreductase subunit 3; NADH-ubiquinone oxidoreductase subunit 4; NADH-ubiquinone oxidoreductase subunit 4L; NADH-ubiquinone oxidoreductase subunit 5; NADH-ubiquinone oxidoreductase subunit 6; ND1 gene; ND2 gene; ND3 gene; ND4 gene; ND4L gene; ND5 gene; ND6 gene; transfer RNA; transfer RNA-Ala; transfer RNA-Arg; transfer RNA-Asn; transfer RNA-Asp; transfer RNA-Cys; transfer RNA-Gln; transfer RNA-Glu; transfer RNA-Gly; transfer RNA-His; transfer RNA-Ile; transfer RNA-Leu; transfer RNA-Lys; transfer RNA-Met; transfer RNA-Phe; transfer RNA-Pro; transfer RNA-Ser; transfer RNA-Thr; transfer RNA-Trp; transfer RNA-Tyr; transfer RNA-Val. ACCESSION X55026 M30937 M61734 KEYWORDS 16S ribosomal RNA homologue; 23S ribosomal RNA homologue; ATPase 6; ATPase 8; COI gene; COII gene; COIII gene; complete genome; cytb gene; cytochrome c oxidase subunit I; cytochrome c oxidase subunit II; cytochrome c oxidase subunit III; cytochrome oxidase b apoprotein; NADH-ubiquinone oxidoreductase subunit 1; NADH-ubiquinone oxidoreductase subunit 2; NADH-ubiquinone oxidoreductase subunit 3; NADH-ubiquinone oxidoreductase subunit 4; NADH-ubiquinone oxidoreductase subunit 4L; NADH-ubiquinone oxidoreductase subunit 5; NADH-ubiquinone oxidoreductase subunit 6; ND1 gene; ND2 gene; ND3 gene; ND4 gene; ND4L gene; ND5 gene; ND6 gene; transfer RNA; transfer RNA-Ala; transfer RNA-Arg; transfer RNA-Asn; transfer RNA-Asp; transfer RNA-Cys; transfer RNA-Gln; transfer RNA-Glu; transfer RNA-Gly; transfer RNA-His; transfer RNA-Ile; transfer RNA-Leu; transfer RNA-Lys; transfer RNA-Met; transfer RNA-Phe; transfer RNA-Pro; transfer RNA-Ser; transfer RNA-Thr; transfer RNA-Trp; transfer RNA-Tyr; transfer RNA-Val. SOURCE Mitochondrion Podospora anserina. ORGANISM Mitochondrion Podospora anserina. REFERENCE 1 (bases 1 to 100314) AUTHORS Cummings,D.J., Domenico,J.M. and Michel,F. TITLE DNA sequence and organization of the mitochondrial ND1 gene from Podospora anserina: analysis of alternate splice sites JOURNAL Curr. Genet. 14 (3), 253-264 (1988) STANDARD No information REFERENCE 2 (bases 1 to 100314) AUTHORS Cummings,D.J., Domenico,J.M. and Nelson,J. TITLE DNA sequence and secondary structures of the large subunit rRNA coding regions and its two class I introns of mitochondrial DNA from Podospora anserina JOURNAL J. Mol. Evol. 28 (3), 242-255 (1989) STANDARD No information REFERENCE 3 (bases 1 to 100314) AUTHORS Turker,M.S., Domenico,J.M. and Cummings,D.J. TITLE Excision-amplification of mitochondrial DNA during senescence in Podospora anserina. A potential role for an 11 base-pair consensus sequence in the excision process JOURNAL J. Mol. Biol. 198 (2), 171-185 (1987) STANDARD No information REFERENCE 4 (bases 1 to 100314) AUTHORS Cummings,D.J. and Domenico,J.M. TITLE Sequence analysis of mitochondrial DNA from Podospora anserina. Pervasiveness of a class I intron in three separate genes JOURNAL J. Mol. Biol. 204 (4), 815-839 (1988) STANDARD No information REFERENCE 5 (bases 1 to 100314) AUTHORS Cummings,D.J., Domenico,J.M., Nelson,J. and Sogin,M.L. TITLE DNA sequence, structure, and phylogenetic relationship of the small subunit rRNA coding region of mitochondrial DNA from Podospora anserina JOURNAL J. Mol. Evol. 28 (3), 232-241 (1989) STANDARD No information REFERENCE 6 (bases 1 to 100314) AUTHORS Cummings,D.J., MacNeil,I.A., Domenico,J. and Matsuura,E.T. TITLE Excision-amplification of mitochondrial DNA during senescence in Podospora anserina. DNA sequence analysis of three unique 'plasmids' JOURNAL J. Mol. Biol. 185 (4), 659-680 (1985) STANDARD No information REFERENCE 7 (bases 1 to 100314) AUTHORS Cummings,D.J., Michel,F. and McNally,K.L. TITLE DNA sequence analysis of the apocytochrome b gene of Podospora anserina: a new family of intronic open reading frame JOURNAL Curr. Genet. 16 (5-6), 407-418 (1989) STANDARD No information REFERENCE 8 (bases 1 to 100314) AUTHORS Cummings,D.J., Michel,F. and McNally,K.L. TITLE DNA sequence analysis of the 24.5 kilobase pair cytochrome oxidase subunit I mitochondrial gene from Podospora anserina: a gene with sixteen introns JOURNAL Curr. Genet. 16 (5-6), 381-406 (1989) STANDARD No information REFERENCE 9 (bases 1 to 100314) AUTHORS Cummings,D.J., Michel,F., Domenico,J.M. and McNally,K.L. TITLE DNA sequence analysis of the mitochondrial ND4L-ND5 gene complex from Podospora anserina. Duplication of the ND4L gene within its intron JOURNAL J. Mol. Biol. 212 (2), 269-286 (1990) STANDARD No information REFERENCE 10 (bases 1 to 100314) AUTHORS Cummings,D.J., Michel,F., Domenico,J.M. and McNally,K.L. TITLE Mitochondrial DNA sequence analysis of the cytochrome oxidase subunit II gene from Podospora anserina. A group IA intron with a putative alternative splice site JOURNAL J. Mol. Biol. 212 (2), 287-294 (1990) STANDARD No information REFERENCE 11 (bases 1 to 100314) AUTHORS Cummings,D.J., McNally,K.L., Domenico,J.M. and Matsuura,E.T. TITLE The complete DNA sequence of the mitochondrial genome of Podospora anserina JOURNAL Curr. Genet. 17 (5), 375-402 (1990) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X55026 BASE COUNT 654 a 294 c 399 g 633 t 3233 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ------guga uguuauugua auuuaauuua auuuaauuua uaauaucauu aauugauaaa 601 gugguguuaa auaaggcgug gcgcaagcuc gccuuuacuc acuuuaacca aaguuGAGUU 661 (UGG-)U-GA U|GGCUC-UG AUUGAACACU -G-UCCA-AA |UA-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGUUU|Aauu aaa--uu(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- -)uuacaguu 841 gca-----gu aaaguuauuc uuuccuuucu guaaaacugg uuauuaagga gguuuaaauu 901 uaggguuuau ucuccucuau uuauaagguu aaucucucua aagggguuuu uuuaauua|A 961 A---A-GU|G GUGUACAGGU GAGUAU-uau g|guu-uuuu --guac-uac cUAAA-AGUA 1021 AAGG------ -------(ca aa-u)----- ---------C CUUUAUA--- ---------- 1081 ---------- ---------- ---------- ---------- -----guaau aaagaa-cgg 1141 ucaug-uuc- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GCUU UUAGAUgaa- --gauaa-aA |a----aucu cGGGGAAA-- 1321 -GGUAGUUGU UA-AG(GUAA uug------- ---------- ---------- ------)CUU 1381 AACAA|---- GCCUAGUAUU C|UCUUA-GU CG|--AAGCU (GAGAAA)GG UUGAUCGAC| 1441 CACAUU-GGG GA(UGAAA-- AA-)AUCCCA A|GGCaa--( ac-g-)--aa GUA----C-A 1501 GCA|GUG-AG GAAUAUUGGU C-AAUGGCC( ---------- ----UAAC)G GCUGA-ACU| 1561 G|-GUAA-C- UU-GGA---- -AGAAUG--- ---GCU-CCA (--u-----a aaa------- 1621 -------a)u ggaguuaauC GAUU|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- -(-------- )uau-cgaau aaaauucugu 1801 auacauaccu -auaaugacg guau-guac- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- -----AUCUU GUCUU|-GAC 1921 -CAA-U---U GCGU-G(-CC AGCAGUC-GC -GGC-AA)-U ACGUAA|--- -GAG-ACU-- 1981 AGUGU-UAUU CAU--CUUAA AUAGGU|UUA AAGGGUACUU -A-GACG|GU AGAAUu--ug 2041 |CCU------ ---------- -------(-- ---uaac)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ------GGGa ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------AC|A AUUUUAC-UA 2281 G-----AGUU -UU-AUau-a -AGAAG--AU c----|uuac ucuaga-GUG ---UAGAG(U 2341 UGUAA)UUC- AUU---AAUA Ccua-ggg-G ACU------- ----GGUAAA -GGC(-GAAG 2401 -)GC|A---- ----AUCUUU U-AUAUAAA- AA---CUGAC GUU--GAAGG ACGAA-GGCU 2461 U-AGG---UC ACAAAAAGG( AUUAGAUAC) CCAA-GUAG| -UCUU-AGC- AGUCAA-UUA 2521 U--GAAU-GC |CA|UAGGUU AGAu--(aua guuaaauaca aacaagggcg uaagcucgua 2581 uuaaauuuua cc-------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)---aUC UAGUCUA-UA AAU(GAAA)G UG-UAAGCAU 2701 U-U|--C|AC C-UCAA-GAG UAAUGUG(-- -GCAA--)CG CAG--GAACU GAAAUCAC-U 2761 AG|ACCGUU- UCUGAC---A CCAGCAGU|G AAGUAUGU-U |AUUUAA-UU CG(AUGACCC 2821 A--------- ----)CGAAA A-ACCUUACC ACAACUUGAA u--------- ---------- 2881 ---------- ---------- ---------- --------------- ---C---AAG UGU-UG|CA- 3121 |CG|-GC--U |G------UC UU-CA|G-UU GAU-|GUU(G --UGA)AACu g-ugg(uuc- 3181 ggu)ccau-G G-AAUUAACG AAA-ACCCUU -----gcuuu auuugua--- -----(aauu 3241 c-)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-ua-aa aua-aagcag uucaccu-g- (-uau-a)-u ggguuaugau 3781 a----AAA-G GGAUCA-AGA C-AAGUCCUC A|UGGC|CUU GAU------- ---------G 3841 U-U-GU-GGG CU-AUA--GA -CGUGCCACA UG--uaccua a-acaa-aga ga--ugcaa- 3901 aaau<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--g uga--)auuu -uagcuaauc uccc-aaaau aggauaaaau 4021 -ua------- --ga-UAUGG --AUUGU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uc) G-GC-U--AU -A--UGAAU- -AAGAAAUUG 4141 C-U--AGUAA U-CGUGGA(- UCACCAU--- --)GACACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--A-AC 4261 UUCGGA-UU- GGUACUAA-C -CACUCGUCA C-AUG--CUG AAA-GGAgu- ---------- 4321 ---------- ---------- ---------- ---------- ---------< augcgcaaua 4381 aguuu-gcug uucuguauua aacaagaaua gaugacg(-g ug)caagcua gauuuuauuu 4441 uuuaauaugg ggcucuucgu augugug--- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---acUCUGA UUAG-UGU-A AAGUCGAAAU ACGGUUCG-U GUA-GU(GGA 4621 -A)GUU-GC- ACGGGACUUA -----UUA-| UACUUAACAA UAAAAAUUUU UAUGAAAAUC 4681 CUCAAAUCAA AUUUUGAUUG AUUUUUAUAU AUAUAUAGGA AUAUAUUCUA AAUAUCACUU 4741 GUUAUAUUUA UUAUAUACUA UAUA|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (6)-HEMIAS 5213 bp RNA RNA 25-JAN-1994 DEFINITION HEMIASCOMYCETES. ACCESSION No information KEYWORDS No information. SOURCE HEMIASCOMYCETES. ORGANISM HEMIASCOMYCETES. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.P.canad 5213 bp RNA RNA 11-JAN-191 DEFINITION Pichia canadensis. ACCESSION No information KEYWORDS No information. SOURCE Pichia canadensis. ORGANISM Pichia canadensis. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: D49702 D31785 LOCUS HASMTPRO 1900 bp ds-DNA PLN 28-MAR-1995 DEFINITION Hansenula wingei mitochondrial gene for mitochondrial transfer RNA for Pro, mitochondrial small subunit ribosomal RNA and mitochondrial transfer RNA for Val. ACCESSION D49702 KEYWORDS mitochondrial transfer RNA; small subunit ribosomal RNA; transfer RNA-Val. SOURCE Mitochondrion Hansenula wingei (organelle Mitochondrion Hansenula wingei, strain 21) DNA. ORGANISM Mitochondrion Pichia canadensis Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Endomycetales; Saccharomycetaceae. REFERENCE 1 (bases 1 to 1900) AUTHORS Okamoto,K., Sekito,T. and Yoshida,K. TITLE Nucleotide sequence, secondary structure and phylogenetic relationship of the small subunit rRNA from yeast Hansenula wingei mitochondria JOURNAL Unpublished (1995) COMMENT Submitted (15-Mar-1995) to DDBJ by: Kazuo Yoshida Department of Biological Science Hiroshima University 1-3-1 Higashi-Hiroshima Hiroshima 724 Japan Phone: 0824-24-7455 Fax: 0824-24-0734 E-mail: r515582@ue.ipc.hiroshima-u.ac.jp. NCBI gi: 725334 FEATURES Location/Qualifiers source 1..1900 /organism="Mitochondrion Hansenula wingei" /mitochondrion /strain="21" /sequenced_mol="DNA" tRNA 12..82 /gene="Pro-tRNA" /standard_name="Pro-tRNA" /note="putative" /function="Protein synthesis" /product="Mitochondrial transfer RNA for Pro" promoter 139..147 /standard_name="transcription initiation site" /note="putative" /function="yeast mitochondrial transcriptional initiation" rRNA 201..1737 /gene="SSU" /standard_name="mt SSU rRNA" /function="Protein synthesis" /evidence=experimental /product="Mitochondrial small subunit ribosomal RNA" misc_feature 205..264 /standard_name="Universally conserved region" /note="putative" /number=1 /label=U1 misc_feature 510..562 /standard_name="Universally conserved region" /note="putative" /number=2 /label=U2 misc_feature 720..804 /standard_name="Universally conserved region" /note="putative" /number=3 /label=U3 misc_feature 919..995 /standard_name="Universally conserved region" /note="putative" /number=4 /label=U4 misc_feature 1031..1148 /standard_name="Universally conserved region" /note="putative" /number=5 /label=U5 misc_feature 1308..1373 /standard_name="Universally conserved region" /note="putative" /number=6 /label=U6 misc_feature 1453..1592 /standard_name="Universally conserved region" /note="putative" /number=7 /label=U7 misc_feature 1657..1714 /standard_name="Universally conserved region" /note="putative" /number=8 /label=U8 misc_feature 1724..1733 /standard_name="mRNA binding sequence (anti-SD-like sequence)" /note="putative" /function="mRNA binding" tRNA 1809..1882 /gene="Val" /standard_name="Val-tRNA" /note="putative" /function="Protein synthesis" /product="Mitochondrial transfer RNA for Val" BASE COUNT 824 a 173 c 240 g 663 t ORIGIN BASE COUNT 672 a 144 c 207 g 514 t 3676 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- -aaaaGAAUA 661 (UGA-)U-GU U|AGUUC-AG ACUAAAUACU -A-UAUA-GA |GA-CA--UU ACAC-A-UGC 721 -AAAUCA-AA CGauu|auuu ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --aaaaauaa 841 aauuga---- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---aaaua|a 961 uua-A-GU|G GUGUAUUCGU GAGUAA---a a|GAU-AGAA --Uaa--GAA CUAAU-AAUU 1021 CAAc------ -------(ua aa-u)----- ---------a UUGAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---aua(aau 1141 -----)aaa- --------ga uuu(aucu)a aauu------ ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GUUA UUAGUCAAG- --CUAUU-ua |--------- -UAGUAUA-- 1321 -GGUAUUAUG UA-GG(AUAA AAGC------ ---------- ---------- ------)CAU 1381 ACAUA|---- GCCCA--CAA U|CUAUA-GC AA|--UUAAU (UAAC--)GU UAUAAUUGU| 1441 CACGUC-GAU AA(UGAAA-- UA-)UAAUCG A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGG C-AAUGAUC( ---------- ---aaaaa)G AUUGA-CCC| 1561 A|-GUUA-U- CU-AUA---- -AUAAUGAAA --aaua-uag ------cuau uaaagc---- 1621 --------uu aaaauu--aa -AUU|ua--- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- -----uuuaa 1801 uaaaaaaaaa aauaaaauug guaaaaaaua aaguuauagg agagugaaaa uaaugauagu 1861 aacuucaaug aaaauuggua auaauaaaua aauuuauuau uauucugaua GUUCC|-AAC 1921 -UAA-A--AU AUGU-G(-CC AGCAGUU-GC -GGU-UA)-G ACAUAG|--- -GGA-GCA-- 1981 AGUAU-UAGU CAU--AUU-- ---GGU|UUA AAGGAUCCGU -AGAAUU|UA AAU------- 2041 ---------- ---------- -------(-- ---aaag)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- --AUUUA-UA 2281 G-----AGUU -AA-UA-aaa gUAAUA--AA -----|UGAA UUAUAA-UAG ---UAAUG(A 2341 UGAAA)UAU- UAU---GAUA AUUA-UAG-G ACA------- ----GACAAG -UUC(-GAAA 2401 -)GU|U---- ----UUUAUU A-UAAAU-U- AA---CUGAC AUU--GAGGG AUGAA-GGCU 2461 A-UAA---UA AUGACAUGG( AUUCGAUAC) CCAA-UUAA| -UUAU-AGC- AGUAAA-CUA 2521 U--GAAU-AC |UU|UUCUau ------(-ua uuaaaaau-- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ -aaAGAA-aA AGA(GAAA)U CA-AUAGUAU 2701 U-C|--C|AC C-AGGA-GAG UAUAAUU(-- -ACUC--)AA UUG--AAACC CAAUACAA-U 2761 AG|ACGGUU- AUAAUC---A AUAGCAGU|G GAGUAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 G--------- ----)CGAAA A-AC-UUACC ACAUUUUGAA uaauuauu-- ---------- 2881 --aua---ua u--------- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- --aau-aauu a--C---AGG CGU-UA|CA- 3121 |UA|-GU--U |G------UC UU-CA|G-UU CGU-|GCU(G --UGA)AGUU UAAGG(UUA- 3181 GUU)CCG-U- A-AACGAACG UAU-CCCUAU auaaauaaa- aaaaau---- -----(auua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|---aua uuu-auaa-u u---uacuau (-uua-a)au gcauaguaaa 3781 -----aAU-A GGAUUA-AGA C-AAAUCAUU A|UGAC|CCU AAU------- ---------A 3841 A-U-GU-GGG CA-AUA--GA -CGUACUAUA AA--aaaaua a-auaa-aau ca--aauaa- 3901 aaua-uauau aaaaaa---- ---------- ---------- -------auu uaauaagaa- 3961 -auaaaac-u ---------- ---------- -uauuuuaau auguuau-au auu-uauaua 4021 uaauaa---u ag---UAUGA --AUUAU-UU A-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-UA-A--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UCAGUUAU(- UAAUU-AA-- --)AUAACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--UAUU 4261 AAUUGU-UU- CGCACUAA-U -UACUCGUCA C-GCG--AUA Agu-uaaaaa uaauuacaaa 4321 aauuaa---- ---------- ---------- ---------- ---------< ---------- 4381 ---------u auuauuuaaa uaauauuuau auc(uuaa)u auuuauuaau uauuuuuaua 4441 a--------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ------uuua 4561 auuuaauaau aauuuuuaua UUAU-UGC-G AAGUCGAAAU ACAGUUAC-U GUA-GG(GGA 4621 -A)CCU-GC- AGUGGGCUAU ---------| auauuaucua uua-cauauu ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.1 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Saccharomyces cerevisiae. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X07799 DEFINITION Yeast mitochondrial 15S rRNA (KL14-4A) SOURCE yeast ORGANISM Mitochondrion Saccharomyces cerevisiae Eukaryota; Plantae; Thallobionta; Eumycota; Hemiascomycetes; Endomycetales; Saccharomycetaceae. REFERENCE 1 (bases 1 to 1649) AUTHORS Weiss-Brummer,B. TITLE Direct Submission JOURNAL Submitted (25-APR-1988) Weiss-Brummer B., Institut fuer Genetik und Mikrobiologie der Universitaet Muenchen, Maria-Ward-Str. 1a, 8000 Muenchen 19, FRG. REFERENCE 2 (bases 1 to 1649) AUTHORS Huettenhofer,A., Sakai,H. and Weiss-Brummer,B. TITLE Site specific AT-cluster insertions in the mitochondrial 15S rRNA gene of the yeast S. cerevisiae JOURNAL Nucleic Acids Res. 16, 8665-8674 (1988) REFERENCE 3 (bases 1 to 1649) AUTHORS Decoster,E., Vassal,A. and Faye,G. TITLE MSS1, a nuclear-encoded mitochondrial GTPase involved in the expression of COX1 subunit of cytochrome c oxidase JOURNAL J. Mol. Biol. 232, 79-88 (1993) FEATURES Location/Qualifiers source 1..1649 /organism="Saccharomyces cerevisiae" /mitochondrion /strain="KL14-4A" rRNA 1..1649 /product="15S ribosomal RNA" mutation replace(1138..1140,"taa") /citation=[3] /note="strain M12-54" BASE COUNT 697 a 144 c 206 g 602 t 3564 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- |--------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GGUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACAC-A-UGC 721 -GAAUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|ua--- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- -----u-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuu-ua uauggauaua 1861 uauauuaaua auaauauuaa uuuuauuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau -UAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---UA GCGAAACGG( AUUCGAUAC) CCGU-GUAG| -UUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAGCAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACCUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(U--- 3181 AAU)GUUCAU A-AACGAACA AAA-CUCCAU auauauaau- uuuaauua-- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-uaauu uuauauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUCA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA G-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu aca~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.2 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Saccharomyces cerevisiae. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X07800 DEFINITION Yeast mitochondrial 15S rRNA (777-3A) SOURCE yeast ORGANISM Mitochondrion Saccharomyces cerevisiae Eukaryota; Plantae; Thallobionta; Eumycota; Hemiascomycetes; Endomycetales; Saccharomycetaceae. REFERENCE 1 (bases 1 to 1651) AUTHORS Weiss-Brummer,B. TITLE Direct Submission JOURNAL Submitted (25-APR-1988) Weiss-Brummer B., Institut fuer Genetik u. Mikrobiologie der Universitaet Muenchen, Maria-Ward-Str. 1a, 8000 Muenchen 19, FRG. REFERENCE 2 (bases 1 to 1651) AUTHORS Huettenhofer,A., Sakai,H. and Weiss-Brummer,B. TITLE Site specific AT-cluster insertions in the mitochondrial 15S rRNA gene of the yeast S. cerevisiae JOURNAL Nucleic Acids Res. 16, 8665-8674 (1988) FEATURES Location/Qualifiers source 1..1651 /organism="Saccharomyces cerevisiae" /mitochondrion /strain="777-3A" rRNA 1..1651 /note="15S rRNA" BASE COUNT 698 a 145 c 205 g 603 t 3562 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GGUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACAC-A-UGC 721 -GAAUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|ua--- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- -----u-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuuuua uauggauaua 1861 uauauuaaua auaauauuaa uuuuauuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau aUAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---UA GCGAAACGG( AUUCGAUAC) CCGU-GUAG| -UUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAGCAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACCUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(U--- 3181 AAU)GUUCAU A-AACGAACA AAA-CUCCAU auauauaau- uuuaauua-- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-uaauu uuauauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUCA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA C-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu aca~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.3 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Saccharomyces cerevisiae. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X14966 DEFINITION Yeast mitochondrial 15S ribosomal RNA gene with ochre suppressor mutation MSU1 SOURCE yeast ORGANISM Mitochondrion Saccharomyces cerevisiae Eukaryota; Plantae; Thallobionta; Eumycota; Hemiascomycetes; Endomycetales; Saccharomycetaceae. REFERENCE 1 (bases 1 to 1998) AUTHORS Fox,T.D. TITLE Direct Submission JOURNAL Submitted (11-APR-1989) Fox T.D., Cornell University, Biotechnology Building, Genetics & Development, Ithaca NY 14853-2703, U S A. REFERENCE 2 (bases 1 to 1998) AUTHORS Shen,Z. and Fox,T.D. TITLE Substitution of an invariant nucleotide at the base of the highly conserved '530-loop' of 15S rRNA causes suppression of yeast mitochondrial ochre mutations JOURNAL Nucleic Acids Res. 17, 4535-4539 (1989) COMMENT The sequence overlaps with that reported by Huettenhofer et. al. in Nucl. Acids Res. 16:8665-8674(1988) X07799, X07800. Data kindly reviewed (19-Jul-1989) by Fox T.D. NCBI gi: 14221 FEATURES Location/Qualifiers source 1..1998 /organism="Saccharomyces cerevisiae" /mitochondrion /strain="V25T-R5" rRNA 251..1901 /note="15S ribosomal RNA" misc_feature 883 /note="MSU1 suppressor mutation" BASE COUNT 699 a 144 c 205 g 603 t 3562 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GGUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACAC-A-UGC 721 -GAAUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|ua--- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- -----u-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuuuua uauggauaua 1861 uauauuaaua auaauauuaa uuuuauuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-A(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau aUAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---UA GCGAAACGG( AUUCGAUAC) CCGU-GUAG| -UUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAGCAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACCUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(U--- 3181 UAA)GUUCAU A-AACGAACA AAA-CUCCAU auauauaau- uuuaauua-- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-uaauu uuauauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUGA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA C-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu aca~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.4 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Saccharomyces cerevisiae. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: V00704 DEFINITION Yeast mitochondrial gene encoding the 15S rRNA. SOURCE yeast ORGANISM Mitochondrion Saccharomyces cerevisiae Eukaryota; Plantae; Thallobionta; Eumycota; Hemiascomycetes; Endomycetales; Saccharomycetaceae. REFERENCE 1 (bases 1 to 1826) AUTHORS Li,M., Tzagoloff,A., Underbrink-Lyon,K. and Martin,N.C. TITLE identification of the paromomycin-resistance mutation in the 15 s rrna gene of yeast mitochondria JOURNAL J. Biol. Chem. 257, 5921-5928 (1982) COMMENT NCBI gi: 13545 FEATURES Location/Qualifiers source 1..1826 /organism="Saccharomyces cerevisiae" /mitochondrion rRNA 101..1786 /note="15S ribosomal RNA" mutation 1614 /note="C is G in paromomycin-resistant mutant" BASE COUNT 707 a 157 c 222 g 600 t 3527 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GGUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACGC-A-UAC 721 -GAGUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|uaguu ccggggcccg gccacggaac cggacccg-- 1681 ---------- ---------- ---------- ---------- ---------a aaggag-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuu--a uauggauaua 1861 uauauuaaua auaauauuaa uuu-auuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau -UAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---UA GCGAAACGG( AUUCGAUAC) CCGU-GUAG| -UUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAACAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACUUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(UUA- 3181 AAU)GUGCAU A-AACGACCA AAA-CUCCAU auauauaau- uuuuuaau-- -----(auau 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-auuaa aaauauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUGA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA C-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu aca~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.5 5213 bp RNA RNA 08-JAN-1984 DEFINITION mitochondria,Saccharomyces cerevisiae(Santa Cruz version). ACCESSION No information KEYWORDS No information. SOURCE mitochondria,Saccharomyces cerevisiae(Santa Cruz version). ORGANISM mitochondria,Saccharomyces cerevisiae(Santa Cruz version). REFERENCE 1 (bases 1 to 100314) AUTHORS No information JOURNAL 5921(1982),Santa Cruz modified 3/8/84 STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 5213) Corresponding GenBank entry: AJ011856 Phylo:Mitochondria,Fungi,Saccharomyces BASE COUNT 729 a 157 c 223 g 617 t 3487 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GGUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACGC-A-UAC 721 -GAGUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUaGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)U UUUAUu--uU -AUU|uaguu ccggggcccg gccacggaac cggacccg-- 1681 ---------- ---------- ---------- ---------- ---------a aaggag-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuu--a uauggauaua 1861 uauauuaaua auaauauuaa uuu-auuauu auuaauaaua uauuuuaauA GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAAAAU -UAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---UA GCGAAACGG( AUUCGAUAC) CCGU-GUAG| -UUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAaua(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAACAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACUUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(UUA- 3181 AAU)GUGCAU A-AACGAGCA AAA-CUCCAU auauauaau- uuuuuaau-- -----(auau 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-auuaa aaauauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAuau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUGA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA C-GCG--UUG AAA-CAUauu auu------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| UAAAUAUCUU AAAUAUUCUU ACAUAAAUAU 4681 UAAUUCAAAU AUUAAUAUAA AUAUUAAUAU UAA~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.6 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Saccharomyces cerevisiae. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: J01459 V00704 DEFINITION yeast (s.cerevisiae) mt 15s rrna gene with paromomycin-resistant mutation ds80. SOURCE yeast (saccharomyces cerevisiae; omega(+) strains d273-10b, ds80 (from d273-10b/a121), kl14-4a) mitochondrial dna, clone pym132 (see comment). ORGANISM Mitochondrion Saccharomyces cerevisiae Eukaryota; Fungi; Eumycota; Hemiascomycetes; Endomycetales; Saccharomycetaceae. REFERENCE 1 (bases 256 to 2081) AUTHORS Li,M., Tzagoloff,A., Underbrink-Lyon,K. and Martin,N.C. TITLE identification of the paromomycin-resistance mutation in the 15 s rrna gene of yeast mitochondria JOURNAL J. Biol. Chem. 257, 5921-5928 (1982) REFERENCE 2 (bases 1 to 412) AUTHORS Osinga,K.A. and Tabak,H.F. TITLE initiation of transcription of genes for mitochondrial ribosomal rna in yeast: comparison of the nucleotide sequence around the 5'-ends of both genes reveals a homologous stretch of 17 nucleotides JOURNAL Nucleic Acids Res. 10, 3617-3626 (1982) COMMENT ds80 is a paromomycin-resistant strain that contains only the par locus. The mutation in the 15S rRNA gene indicates that the par locus is a genetic marker of the gene [1]. [2] also sequenced the 5' end of the 21S rRNA gene. Complete source information: yeast (saccharomyces cerevisiae; omega(+) strains d273-10b [1], ds80 (from d273-10b/a121) [1], kl14-4a [2]) mitochondrial dna, clone pym132 [1]. NCBI gi: 343907 FEATURES Location/Qualifiers unsure 23..27 /note="[2] uncertain about length of g-tract" misc_RNA 279..>2041 /note="15S rRNA precursor (15.5S) [2]" rRNA 356..2041 /note="15S rRNA" mutation 1869 /note="c in wild-type; g in ds80" source 1..2081 /organism="Saccharomyces cerevisiae" /mitochondrion BASE COUNT 707 a 158 c 221 g 600 t 3527 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GGUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACGC-A-UAC 721 -GAGUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|uaguu ccggggcccg gccacggaac cggacccg-- 1681 ---------- ---------- ---------- ---------- ---------a aaggag-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuu--a uauggauaua 1861 uauauuaaua auaauauuaa uuu-auuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau -UAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---UA GCGAAACGG( AUUCGAUAC) CCGU-GUAG| -UUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAACAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACUUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(UUA- 3181 AAU)GUGCAU A-AACGACCA AAA-CUCCAU auauauaau- uuuuuaau-- -----(auau 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-auuaa aaauauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUCA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA C-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu aca~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.7 5213 bp RNA RNA 06-JUL-1989 DEFINITION Mitochondrion Saccharomyces cerevisiae.; 15S ribosomal RNA; ribosomal RNA. ACCESSION V00702 M25039 KEYWORDS 15S ribosomal RNA; ribosomal RNA. SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 (bases 1 to 1826) AUTHORS Sor,F. and Fukuhara,H. TITLE ribosomal RNA of yeast Nucleotide sequence of the gene for the mitochondrial 15S JOURNAL C. R. Acad. Sci., D, Sci. Nat. 291 (12), 933-936 (1980) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: V00702 BASE COUNT 709 a 154 c 232 g 613 t 3505 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GUUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACGC-A-UAC 721 -GAGUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|uaguu ccggggcccg gccacggagc cgaacccg-- 1681 ---------- ---------- ---------- ---------- ---------a aaggag-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuu--a uauggauaua 1861 uauauuaaua auaauauuaa uuu-auuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau -UAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---U- GCGAAACGG( AUUCGAUAU) UCGU-GUAG| UUUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAACAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACUUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(UUA- 3181 AAU)GUGCAU A-AACGAGCA AAA-CUCCAU auauauaau- uuu------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ --auauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUGA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA G-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAA-U ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu acauagguau 4681 uaaucuaaau auugaauaug agguguungu agu~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.cer.8 5213 bp RNA RNA 15-JAN-1999 DEFINITION Mitochondrion Saccharomyces cerevisiae.; . ACCESSION AJ0118 6 KEYWORDS . SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 (bases 1 to 85779) AUTHORS Foury,F., Roganti,T., Lecrenier,N. and Purnelle,B. TITLE The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae JOURNAL FEBS Lett. 440 (3), 325-331 (1998) STANDARD No information REFERENCE 2 (bases 1 to 85779) AUTHORS MIPS. TITLE Direct Submission JOURNAL Submitted (16-DEC-1998) Data collected by MIPS on behalf of the European yeast mitochondrial genome sequencing project. MIPS at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a D-82152 Martinsried, Germany; E-mail: Mewes@mips.biochem.mpg.de STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: AJ011856 BASE COUNT 697 a 144 c 206 g 602 t 3564 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GGUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACAC-A-UGC 721 -GAAUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|ua--- ---------- --uaaauauu ---------- 1681 ---------- ---------- ---------- ---------- ---------- -------aaa 1741 uauu-uaua- --auaauaau aauaauaaua uauauauaua aauugauuaa aaauaaaauc 1801 cauaaauaau uaaaauaaug auauuaauua ccauauauau -uuuuauaug gauauauaua 1861 u-uaauaaua auauua-au- uuu-auuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau aUAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---UA GCGAAACGG( AUUCGAUAC) CCGU-GUAG| -UUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)UAUaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAGCAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACCUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(UUA- 3181 A--)GUUCAU A-AACGAACA AAA-CUCCAU auauauaau- uuuaauua-- -----(uaua 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-uaauu uuauauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUGA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA C-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu aca------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS mt.S.cer.9 5213 bp RNA RNA 26-MAY-1995 DEFINITION Mitochondrion Saccharomyces cerevisiae.; 15S ribosomal RNA; transfer RNA-Trp. 11 of 19. ACCESSION L36895 M62622 KEYWORDS 15S ribosomal RNA; transfer RNA-Trp. 11 of 19. SOURCE Mitochondrion Saccharomyces cerevisiae. ORGANISM Mitochondrion Saccharomyces cerevisiae. REFERENCE 1 (bases 1 to 4350) AUTHORS de Zamaroczy,M. and Bernardi,G. TITLE Saccharomyces cerevisiae--a review The primary structure of the mitochondrial genome of JOURNAL Gene 47 (2-3), 155-177 (1986) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: L36895 BASE COUNT 697 a 154 c 222 g 597 t 3543 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------a guaaaaaauu uauaaGAAUA 661 (UGA-)U-GU U|GUUUC-AG AUUAAGCGCU -A-AAUA-AG |GA-CA--UG ACGC-A-UAC 721 -GAGUCA-UA CGuuu|auua uu-------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- --gauaa--- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- -gauaaua|a 961 aua-U-GU|G GUGUAAACGU GAGUAA-uuU U|AUUAGGAA --UUaauGAA CUAUA-GAAU 1021 AAGc------ -------(ua aa-u)----- ---------a CUUAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- --uauuauua uauaaa(aau 1141 aa---)uuua uauaauaaaa a--(----)- ----ggauau auau(aua-) auauauauuu 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------AUCU AUAGUCAAG- --CCAAU-AA |--------- -UGGUUUA-- 1321 -GGUAGUAGG UU-UA(UUAA GAGU------ ---------- ---------- ------)UAA 1381 ACCUA|---- GCCAA--CGA U|CCAUA-AU CG|--AUAAU (GAAA--)GU UAGAACGAU| 1441 CACGUU-GAC UC(UGAAA-- UA-)UAGUCA A|UAUCU--( au-a-)--AG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGA C-AAUGAUC( ---------- ----GAAA)G AUUGA-UCC| 1561 A|-GUUA-C- UU-AUU---- -AGGAUGAUA --UAUA-AAA (--------- -aua------ 1621 --------)u uuuauu--uU -AUU|uaguu ccggggcccg gccacggagc cgaacccg-- 1681 ---------- ---------- ---------- ---------- ---------a aaggag-aaa 1741 uauuaaauau uuauaauaau aauaauaaua auauau-aua uauaaauuga uuaaaaauaa 1801 aauccauaaa uaauuaaaau aaugauauua auuaccauau auauuuu--a uauggauaua 1861 uauauuaaua auaauauuaa uuu-auuauu auuaauaaua uauuuuaaua GUCCU|-GAC 1921 -UAA-U--AU UUGU-G(-CC AGCAGUC-GC -GGU-AA)-C ACAAAG|--- -AGG-GCG-- 1981 AGCGU-UAAU CAU--AAU-- ---GGU|UUA AAGGAUCCGU -AGAAUG|AA UUAUA----- 2041 |--------- ---------- -------(-- ----uau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- UAUAAUU-UA 2281 G-----AGUU -AA-UAaaau -UAAUU--AA -----|AGAA UUAUAA-UAG ---UAAAG(A 2341 UGAAA)UAAU AAU---AAUA AUUA-UAA-G ACU------- ----AAUAUA -UGU(-GAAA 2401 -)AU|A---- ----UUAAUU A-AAUAU-U- AA---CUGAC AUU--GAGGG AUUAA-AACU 2461 A-GAG---U- GCGAAACGG( AUUCGAUAU) UCGU-GUAG| UUUCU-AGU- AGUAAA-CUA 2521 U--GAAU-AC |AA|UUAUUU AUAAUA(-ua uau------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)uauaUA UAAAUAA-UA AAU(GAAA)A UG-AAAGUAU 2701 U-C|--C|AC C-UGAA-GAG UACGUUA(-- -GCAA--)UA AUG--AAACU CAAAACAA-U 2761 AG|ACGGUU- ACAGAC---U UAAGCAGU|G GAACAUGU-U |AUUUAA-UU CG(AUAAUCC 2821 A--------- ----)CGACU A-ACUUUACC AUAUUUUGAA uauuauaa-- ---uaauua- 2881 (--------u ua-)-uaauu a--------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->uua-uauu a--C---AGG CGU-UA|CA- 3121 |UU|-GU--U |G------UC UU-UA|G-UU CGU-|GCU(G --CAA)AGUU UUAGA(UUA- 3181 AAU)GUGCAU A-AACGAGCA AAA-CUCCAU auauauaau- uuu------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ --auauua-- ----uuu-au (-uaa-u)au aaa---ga-- 3781 ------AA-G GAAUUA-AGA C-AAAUCAUA A|UGAU|CCU UAU------- ---------A 3841 A-U-AU-GGG UA-AUA--GA -CGUGCUAUA AU--AAAAUG A-UAAU-AAA AU--UAUau- 3901 aaaa(--- -----)uuuu -UAAUA-UAU UUUU-UUAUU AUA-UAUUAA 4021 ---------- -----UAUGA --AUUAU-AA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) G-AU-U--AU -A--UGAAA- -AAAGAAUUG 4141 C-U--AGUAA UACGUAAA(- UUAGU-AU-- --)GUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U-CU 4261 AACUGU-UU- CGCACUAA-U -CACUCAUCA C-GCG--UUG AAA-CAUAUU AUU------- 4321 ---------- ---------- ---------- ---------- ---------< ---------a 4381 ucuua-uuau uuauauaaua uuuuuuaaua aau(auua)a uaauuauuaa uuuauauuua 4441 uuuauaucag a--------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------a auaauAUGAA UUAA-UGC-G AAGUUGAAAU ACAGUUAC-C GUA-GG(GGA 4621 -A)CCU-GC- GGUGGGCUUA ---------| uaaauaucuu aaauauucuu aca------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS mt.W.satur 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Williopsis saturnus var. mrakii. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Williopsis saturnus var. mrakii. ORGANISM Mitochondrion Williopsis saturnus var. mrakii. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: X71392 ID MIWMTRNAV standard; DNA; ORG; 3709 BP. XX AC X71392; XX DT 16-APR-1993 (Rel. 35, Created) DT 16-APR-1993 (Rel. 35, Last updated, Version 2) XX DE W.mrakii mitochondrial DNA for tRNA-Val, 15S rRNA and 21S rRNA DE (partial) XX KW 15S ribosomal RNA; 21S ribosomal RNA; ribosomal RNA; KW small subunit ribosomal RNA; transfer RNA; transfer RNA-Val. XX OS Williopsis mrakii OC Eukaryota; Plantae; Thallobionta; Eumycota; Hemiascomycetes; OC Endomycetales; Saccharomycetaceae. XX OG Mitochondrion XX RN [1] RP 1-3709 RA Drissi R.; RT ; RL Submitted (07-APR-1993) on tape to the EMBL Data Library by: RL R. Drissi, Institut Curie Biologie, Bat 110 Centre Universitaire, RL 91405 Orsay Cedex 13, FRANCE XX RN [2] RP 1-3709 RA Drissi R., Sor F., Fukuhara H.; RT "DNA sequences coding for the ribosomal small subunit RNA and Vayl RT tRNA from the lineard mitochondrial genome of Williopsis mrakii"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1..3709 FT /organism="Williopsis mrakii" FT /mitochondrion FT /strain="CBS 1707" FT promoter 42..50 FT /note="15S rRNA promoter" FT rRNA 50..1666 FT /product="15S ribosomal RNA" FT tRNA 1822..1895 FT /product="tRNA-Val" FT promoter 1955..1963 FT /note="21S rRNA promoter" FT rRNA 1963..>3709 FT /product="21S ribosomal RNA" XX SQ Sequence 3709 BP; 1530 A; 324 C; 497 G; 1358 T; 0 other; BASE COUNT 644 a 152 c 225 g 596 t 3596 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 -----aaaua uaauaauaau uaaauuauua uuuuagagga auuauaaaau auagaGAAUA 661 (UGA-)U-GU U|AGUUC-AG ACUUAAUACU -A-UAUA-GA |GA-CA--UA ACAC-A-UGC 721 -AAAUCA-AA CGauu|auu- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---------- 841 ----uaauug auauauaauu auauaauauu aauauuauau aauucaaaua au-------- 901 ---------- ---------- ---------- ---------- ---------- ----aaua|a 961 uua-A-GU|G GUGUAUCCGU GAGUAA---u a|AAU-AGAA --UUa--GAA CUAAU-AUAU 1021 CUUu------ -------(ua aa-u)----- ---------g AGGAAUA--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---aua(aau 1141 -----)aaa- ----gauaau uau(uaau)u aauuauu--- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------GAUA UUAGUCAAG- --CUAUU-ag |--------- -CAGUAUA-- 1321 -GGUAUUAUG UA-GG(AUAA UAGC------ ---------- ---------- ------)CAU 1381 ACAUA|---- GCCGA--UAA U|CUGUA-GC AA|--UUAAU (UAAC--)GU UAUAAUUGU| 1441 CACGUC-GAU UA(UCAAA-- UA-)CAAUCG A|UAUCU--( au-a-)--UG AUA----C-A 1501 GCA|GUG-AG GAAUAUUGGG C-UUAGAUC( ---------- ----GAAA)G AUUGA-CCC| 1561 A|-GUUA-U- CU-AUA---- -AUAAUGAAA --Uuuc-aau ---------- -uuu------ 1621 ---------- -cuuau--uU -AUU|uuuuu uuaaaauuua aauauaguaa agaaaaaauu 1681 guuauaaauu aaaguuauag acuagcgaga auaaugauag uagcuaucau cagauuauga 1741 ugaauauaaa auuuauuuuu uuauaugucg ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ------auUA GUACC|-GAU 1921 -UAA-G--AU AUGU-G(-CC AGCAUUC-GC -GGU-UA)-U ACAUAG|--- -GGU-GCA-- 1981 AGUAU-UAGU UAU--AUU-- ---GGU|UUA AAGGAUCCGU -AGAAUU|UA UAUAU----- 2041 ---------- ---------- -------(-- ----aau)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- -------a|u AUAUAUA-UA 2281 G-----AGUU -AA-CA-aua gUAAUA--AA -----|UGAA UUAUAA-UAG ---UAAUG(A 2341 UGAAA)UAU- UAU---GAUA AUUA-UAG-G ACA------- ----GUCAAA -AUU(-GAAA 2401 -)AU|A---- ----UUUAUU A-UAUGU-U- AA---CUGAC AUU--GAGGG AUGAA-GGCU 2461 A-AAU---UA AUGAAAUGG( AUUCGAUAC) CCAA-GUAA| -UUUU-AGC- AGUAAA-CUA 2521 U--GAGU-AC |UG|AAUAUU UAU---(-aa uaa------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----AU AAAUAUU-UA AGA(GAAA)U CA-AUAGUAU 2701 U-C|--C|AC C-AGGA-GAG UAUAAUA(-- -ACUC--)AA UGG--AAACC CAAUACAA-U 2761 AG|ACGGUU- AUAAUC---A AUAGCAGU|G GAGUAUGU-U |AUUUAA-UU UG(AUAAUCC 2821 C--------- ----)CAAAA A-UC-UUACC ACAUCUUGAA uauuaucuuu aa-------- 2881 ---------- ---------- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- --uga-uauu a--C---AGG CGU-UA|CA- 3121 |UA|-GU--U |G------UC UU-CA|G-UU CGU-|GCU(G --UGA)AGUU UAAGG(UUA- 3181 GUU)CCG-U- A-AACGAACG CAU-UCCUGU au---aaaua uauuaa---- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-uauuu aua-auuc-- u-uuauu-ua (aaug-c)au aaa---gag- 3781 -----AAU-A GGUUUA-AGA C-AAAUCAUU A|UGAC|CCU AAU------- ---------G 3841 U-U-GU-GGG CU-AUA--GA -CGUACUAUA AA--auaaua u-auaa-aau uu--aauua- 3901 aaua-gugau auuuaaugau aaauacaacu uauuaaaaua uguu------ ---------- 3961 ---------- ---------- ---------- --------au --------au auu-aauaua 4021 uaauuu---u ag---UAUGA --AUUAU-AU C-C(------ ---------- ---------- 4081 ---------- ---------- UGUAAu-uc) G-GA-U--AU -A--UGAAA- -CAAGAAUUG 4141 C-U--AGUAA UCUGUAAU(- UAAGU-AU-- --)AUUACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--UAUU 4261 AAUUGU-UU- CGCACUAA-U -UACUCGUCA C-GCG---UA Aau-uaaaau aaauaacaaa 4321 aauaaa---- ---------- ---------- ---------- ---------< uauuauauu- 4381 auuaa-ucuu uuauuauuua auaauugu-- uuug-auuuu uua-a----- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ------uuuu 4561 auuuaguuau cuguuuuaua UUAU-UGC-G AAGUCGAAAU ACAGUUAC-U GUA-GG(GGA 4621 -A)CCU-GC- AGUGGGCUAU ---------| auuuaaucuu uauucauauu caca~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (6)-MITOSP 5213 bp RNA RNA 25-JAN-1994 DEFINITION MITOSPORIC ASCOMYCOTA. ACCESSION No information KEYWORDS No information. SOURCE MITOSPORIC ASCOMYCOTA. ORGANISM MITOSPORIC ASCOMYCOTA. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.B.bassi 5213 bp RNA RNA 23-MAR-1997 DEFINITION Mitochondrion Beauveria bassiana.; . ACCESSION U91338 KEYWORDS . SOURCE Mitochondrion Beauveria bassiana. ORGANISM Mitochondrion Beauveria bassiana. REFERENCE 1 (bases 1 to 1561) AUTHORS Hegedus,D.D., Pfeifer,T.A., Mulyk,D.S. and Khachatourians,G.G . TITLE Nucleotide sequence and secondary structure prediction of the Beauveria bassiana mitochondrial small ribosomal RNA JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 1561) AUTHORS Hegedus,D.D., Pfeifer,T.A., Mulyk,D.S. and Khachatourians, G.G. TITLE Direct Submission JOURNAL Submitted (26-FEB-1997) Zoology, University of British Columbia, 6270 University Blvd., Vancouver, BC V6T 1Z4, Canada STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U91338 BASE COUNT 528 a 216 c 326 g 483 t 3660 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ------aaua uaguuGAGU- 661 (UUG-)U-GA U|-GCUC-UG AUUGAACACU -G--UCA-AG |UG-CU--UG ACAC-A-UGC 721 -UAAUCG-AA CGuuu|uaau uaagagu--- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- ---------- 841 ----gguuua gcuuaucaug uaaguaauag gccu------ ---------- ---------- 901 ---------- ---------- ---------- ---------- -cnccucuuc auaauuaa|a 961 a---A-GU|G GUGUACAGGU GAGUAUaaua a|uau-uuau -gcc---GNC CUUAG-AGUG 1021 AAGA------ -------(ua aa-u)----- ---------U CUUCAUA--- ---------- 1081 ---------- ---------- ---------- ---------- ---------- --uaau(aaa 1141 ggg--)auua ---------- agu(auu-)g gg-------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- -----nG-nU UAAGAggau- gauaaauauu |--------u uCGGGAUA-- 1321 -GGUAGUAGU GA-AG(GUUA UGU------- ---------- ---------- ------)CUU 1381 CACUA|---- GCCuu-aacU C|UCGUA-GU CG|--AAGCU (GAAA--)GG UUGAUCGAC| 1441 CACAUU-GGG UC(UGAAA-- AA-)AGCCCA A|UGCA---( ag-uu)---A GUA----C-A 1501 GCA|GUG-AG -AAUAUUGGU C-AAUGGCC( ---------- ----UAAC)G GCUGA-ACU| 1561 G|-GCAA-C- UU-GGA---- -GAAGUGUUA -agucuuuau u-----unn- guauu----- 1621 ---------- guaaua---g -acu-acguu uuaauaagcu au-------- ------augu 1681 aaauauagug cuuaggcgga gcuuauuaac acacaaauua aagauuaaau uaguauugaa 1741 ugaaacuuug uuuauauauc gauaa----- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ugacgauau- auauauua-U GUCUU|-GAC 1921 -CAA-U---U ACGU-G(-CC AGCAGUC-GC -GGU-AA)-U ACGUAA|--- -GAG-ACU-- 1981 AGUGU-UAUU CAU--cuuaa uuaGGU|NUA AAGGGUACUC -A-AACG|Gu cuguu----- 2041 ---------- ---------- -------(-- uugcacc)-- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- aa-agaC-UA 2281 G-----AGUU -AU-AU--ag aAGAAG--GU -----|AGUA CCUUAA-GUG ---UAGAG(A 2341 UAAAA)UUU- ugu---UAUA CAGG-AGG-G ACUu------ ----AGAAAA -GGC(-GUAG 2401 -)NC|A---- ----ACCUUC U-AAGUAAU- AA---CUGAC GUU--GAAGG ACGAA-GGCA 2461 U-AGG---UC ACGAACAGG( ACUAGUAAC) CCAA-GUAG| -UCUU-UGC- AGUCAA-UGA 2521 U--GAAU-GC |CA|UAGGUU AGA---(-ua aaaau----- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----UU AAGUCUA-UA AAU(GAAA)A UG-UAAGCAU 2701 U-U|--C|AC C-UCAA-GAG UAAUGUG(-- -GCAA--)CG CAG--GAACU GAAAUCAC-U 2761 AG|ACCGUU- UCUGAC---A CCAGUAGU|G AAGUAUGU-U |GUUUAA-UU CG(AUGAUCC 2821 A--------- ----)CGAAA A-ACCUUACC ACAAUUUGUa uau------- ---------- 2881 ---------- ---------- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- -------uuu a--C---AGG AGU-UG|CA- 3121 |CG|-GC--U |G------UC UU-CA|G-UU GAU-|GUU(G --UGA)AACU -GUGG(UU-- 3181 --U)CCA-U- G-AAUUAACG CAA-UCCCUU -----gcuu- uau------- -----(---- 3241 --)<-uuuug uucguacaaa cuaaggcuua guuaaagcua uauuuaguua c--------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|-----u aua-aagcau uugaccc-ua (-uaa-u)uu gggaagaaa- 3781 -----AAA-G GGAGUA-AGA C-AAGUCAUC A|UGGC|CUU AAU------- ---------A 3841 C-U-GU-GGG CU-AUA--GA -CGUGCCACA UA--agccua u-acaa-aga ga--ugcga- 3901 aaau------ ---------- ---------- ---------- ---------- ---------- 3961 ---------- ------(--G UGA--)auuc -uagcaaauc ucaa---aau agg-aaauaa 4021 a--------- -----AAGGA --AUUCU-AG U-C(------ ---------- ---------- 4081 ---------- ---------- UGUUUa-ac) G-AC-U--AU -A--UGAAU- -AAGUAAUUA 4141 C-U--AGUAA U-CGUGAA(- UAAGG-AU-- --)GUCACGG A-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAU--U--u 4261 aUGGGA-UU- GGUACUAA-C -CACUCGUC- G-AUG--CUG AAA-GGAgu- ---------- 4321 ---------- ---------- ---------- ---------- ---------< uuauacaauu 4381 aaguu-ugcu cuuuuauuag uaaaaaaaua aaa(uaa-)u uagauuuugu auauauuauu 4441 auaaaauucu ucgcauguau a--------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---gCUCUAA UUAG-UGU-U AAGUCGAAAU ACGGUUCG-C GUA-GU(GGA 4621 -A)GUU-GC- GCGGGAuauu aag------| ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS (5)-BASIDI 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.A.aeger 5213 bp RNA RNA 12-JUN-1996 DEFINITION Mitochondrion Agrocybe aegerita.; . ACCESSION U54637 KEYWORDS . SOURCE Mitochondrion Agrocybe aegerita. ORGANISM Mitochondrion Agrocybe aegerita. REFERENCE 1 (bases 1 to 3948) AUTHORS Gonzalez,P., Barroso,G. and Labarere,J. TITLE aegerita Complete sequence and secondary structure of the mitochondrial small subunit ribosomal RNA and evidence of its group-IC2 intron from the cultivated basidiomycete Agrocybe JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 3948) AUTHORS Labarere,J. TITLE Direct Submission JOURNAL Submitted (10-APR-1996) Jacques Labarere, Molecular Genetics and Improvement of Edible Mushrooms, Bordeaux II University, I.N.R.A. CRA de Bordeaux BP 81, Villenave d'Ornon Cedex 33883, France STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U54637 BASE COUNT 672 a 251 c 335 g 642 t 3313 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ------cuuu uggaaGAAUU 661 (UAA-)U-UU U|GGUUC-UG AUUGAACGUU -U-UUCA-GU |AG-UU-UUA AGAC-A-UGC 721 -Aaaucg--u uauuu|u--- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- -)agaaaaaa 841 guauagaa-- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- --------|- 961 ----u-aa|g guguaaaggu gaguaa--UG A|UAA-AUAa --ga---uac cuuaucaguc 1021 uuuu------ ---------- cg-aa---au agaggauacu uauauaauau aaauuauaug 1081 cuaauauagc uaaauuauga agaaaggaau uuuucu---- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 ---------- ------acua uaagagucg- --auuua-uu |--------- -UUGUUUAau 1321 uGGUAGUUGG UA-GG(GUAA AGG------- ---------- ---------- ------)CCU 1381 ACCAA|---- GCCUA--CGA U|CAAUA-GC CA|--AGUUU (GAAA--)GA ACAAAUGGC| 1441 CACAUU-GGG AA(UGAAA-- A--)GCCCCA A|AUUGC--( -uuaa)--GC AAU----C-U 1501 GCA|GUC-AA GAAUAUUAGU C-AAUGCUC( ---------- ----GCAA)G AGUGA-ACU| 1561 A|-GCUA-A- CU-GAA---- -aucacaaaa ucac------ (-------uu aauc------ 1621 --------)- -gugguuauu -gug|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ------auaa cguaagggaa 1801 aaaaaugaua uuaccuuacu au-------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- --------AA GUGUU|-GUC 1921 -UAA-AuuAC UGGU-G(-CC AGAAGAC-UC -GGU-AA)-C ACCAGA|--- -AAC-GCG-- 1981 AACGU-UAGU CGU--CUUAA ACAGGC|GUA AAGGGUAAGU -A-GGCU|gc uuuaaa--uu 2041 |uucua--uu uuuaaacuaa auuuacu(-- --uuua-)ag uaaauaagcu cuaaauuuaa 2101 uaaauaaaaa uaaaauuuuc aacucgcaau ccucaggauu uuuaugagaa aauuaaauaa 2161 auuugaccug uaauuuuauu aagaucagua aaaauagaau ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------aa|a uuaaagc-UA 2281 G-----AAUC -Au-aaug-g -agaua--aa c-caa|AUAA UACUUAUGUG ---UAAGG(A 2341 UGAUA)UCU- AAA---GAUA CUAA-GUA-G AAU------- ----ACUAAU -GGU(-GAAA 2401 -)AC|UU--- ----uuuauc uaguaa--u- ga---uuGAC GCUc-GAGGA ACGAA-AGUG 2461 --GAA---UA GGGAAUAGG( AUUAGAUAC) CCACgUUAC| -CUCU-CAC- CGUCAA-CGA 2521 U--GAAU-GG |UA|guuauu aguuua(--- ---------- ---------- ----aua--- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-uaaau uaguaac-GA UGU(UAAC)G CGAUAACCAU 2701 U-C|--C|GC C-UUGA-GAG UACGGUU(-- -GCAA--)AA CUG--AAACC AAAAAAAU-U 2761 AG|UCGGUC- UCGGAG--CA AACGAAGU|G AAGCAUGU-U |AUUUAA-UA CG(AAAGUAC 2821 G--------- ----)CGUAA A-AUCUUACC AGUUCUUG-C AUA------- ---------- 2881 ---------- ---------- ---------- --------------U A--C---AGG UGU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UC CGU-|AUU(G --UGA)AAAG UGAGG(UUA- 3181 ACU)CCA-C- U-AACGGACG AAA-UCCCUG -----UUGUU AAuuu----- -----(auac 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ uua-acuauu gaugauu-au (uaaa-u)au uuu-ca---- 3781 -----UUU-G GGGCUA-AGA C-AAGUCGUU A|UGGC|CCU CAU------- ---------G 3841 A-A-CU-GGG CU+AUA--GA -CGUGCUGCA AA--AACUUU U-ACAA-UGU GA--CGCAA- 3901 AAcu(--- -----)gguu -uaGCUAAUC AAU--AAAAA AAG-UUAuuu 4021 uuauuauuuu uaua-AACGG --AUUGU-UG C-C(------ ---------- ---------- 4081 ---------- ---------- UGGAAu-uc) G-GC-A--AC -A--UGAAG- -AAGGCCUUU 4141 C-G--AGUAA U-CGUUGA(- UUAGU-AUU- --)GCAACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -gau--ugaa 4261 -uccgu-GA- UGAACUAA-C -UGUCUGUCG C-UGG--GGA GGA-GUUCcg auugggccaa 4321 auccccuuua auaaau-aug aag------- ---------- -(------)< ---------- 4381 ---aa-caaa aguauacacu auauuaaauu uauauuaaaa auauuuguua aauauuuuuc 4441 uaauuau(uu uuaauu)aag uguaguuauu cuuauuuguu acuuauguaa cuuuauauag 4501 ugcaguuuaa cucuuuuguu -->------- ---------- -----gagau uuauuaauau 4561 cgauuaaccc uuCUGAGUAA CAUU-UCA-A AAGUCAUAGC AAGGUAGCUU GUA-CU(GGA 4621 -A)AGUCGC- UGCUGGAAAA UAUA-----| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.S.sinus 5213 bp RNA RNA 11-JAN-191 DEFINITION Suillus sinuspaulianus. ACCESSION No information KEYWORDS No information. SOURCE Suillus sinuspaulianus. ORGANISM Suillus sinuspaulianus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Thesis; Yunan Li, University of California at Berkeley BASE COUNT 1006 a 300 c 408 g 958 t 2541 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|gagcu cucauuuaaa aaauuugggg 541 cugaaauaau aaaaaaaaua aauagauaaa uauuaaaaau auaaaagaga uauuaaauau 601 ugcauuaaag caaauaaaau acgacaauaa aaaaaaauug uuuaauaaaa agaaaGAAUU 661 (UAA-)U-UU U|GGUUC-CG AUUGAACGUU -U-UUCA-GU |AG-UU-UUA AGAC-A-UGC 721 -AAAUCG--U UAuuu|c--- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ---------- -)ugaaagua 841 aauuuuuauu uaaaauuau( auaa)auaau aacuaaauaa aaaugauaau au-------- 901 ---------- ---------- ---------- ---------- ---------- -------g|a 961 a--au-AA|G GUGUAGAGGU GAg-ga--UA G|UAA-AUaa --ga---uac ccugu-aguc 1021 uuca------ -------(ua ga-u)----- ---------a gaagaua--- -uuauucuaa 1081 guaaauuuuu uaaauuuauu acuaguauuu uuaaauuaau uugcuugcau uauauaaaau 1141 uauaauuguu uuucauuaau ugcaaaaauu uaaauaaaaa ugacuaaagc aaaaaaauua 1201 uuuaaauaac aauaauguaa aauaaaugaa uaaaauaaaa aagcuauuuu uauuaaaaaa 1261 aggaaauuuu cu----GCUA UAGGAUUCU- --AUUUA-UU |--------- -UUGAUUA-- 1321 -GGUAGUUGG UAuGG(GUAA AGG------- ---------- ---------- ------)CCU 1381 ACCAA|---- GCCGA--CAA U|CAAUA-GC CA|--uGCUU (GACA--)GA GCAGAUGGC| 1441 CACAUU-GGG AA(UGaaa-- u--)CUCCCA A|GUAGU--( uuuau)--AC UAC----C-A 1501 GCA|GUC-AA GAAUAUUAGU C-AAUGCUC( ---------- ----GUAA)G AGUGA-ACU| 1561 A|-GCUA-A- CU-GAA---- -aucgcaaau ---------- (-------gu guc------- 1621 --------)- -----a-uuu -gug|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ------auaa aguaagagaa 1801 aauuaugaua uuaucuuacu ac-------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- --------UA GUGCU|-GUC 1921 -CAA-A--AC UGGU-G(-CC AGAAGAC-UC -GGU-AA)-G GCCAGA|--- -GGC-GCA-- 1981 AACGU-UAGU CGU--CCUAA UCAGGC|GUA AAGGGUUUGU -A-GGCU|gc uuugaa--ag 2041 |ucuua--uu auua------ -uaau--(-- --agcu-)-- auua------ ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------a augauaagau ---------- ---------- 2221 ---------- ---------- ---------- ---------- ------ga|a uugaagc-UA 2281 G-----AAUC -Ua-auag-a -gggua--aa a-caa|AUAA UAUUUA-AAG ---UAAGG(A 2341 UUAAA)UCU- CAA---GAGU UUAG-AUG-G AAU------- ----ACUAAC -GGU(-UAAA 2401 -)GC|U---- ----uuuauc uaucuac-A- GA---UUGAC GCU--GAGAA ACGAA-AGGG 2461 A-GGU---AA GGAAACAGG( AUUAGAUAC) CCAA-CUAC| -UGCU-CCC- UGUCAA-CGA 2521 U--GAAU-GG |UG|GUUGCU AGUuau(aac uacuuuaagu aaauauuuua uauuauauaa 2581 gauaaaaua- aguaguuaaa ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)-augAC UGGUAGC-GA UGC(UAAC)G CGUUAACCAU 2701 U-C|--C|GC C-UUGU-GAG UACGACU(-- -GCAA--)AG UUG--AAAAC AAAAAAAU-U 2761 AG|UCGGUU- UCGAAG--CA AACGAAGU|G AAGCAUGU-U |AUUUAA-UA CG(AUAAUCC 2821 G--------- ----)CGUAA A-AUCUUACC AGUUCUUG-C AUA------- ---------- 2881 ---------- ---------- ---------- --------------U A--C---AGG UGU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UC CGU-|gcu(G --UGA)gaaG UUUGG(UUA- 3181 AAU)CCG-C- U-AACGGACA AAA-UCCCUG -----UUGUU AAuuu----- -----(auac 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ UUA-ACAAUu aaugaua-cu (gaua-g)ag cau-ca---- 3781 -----UUU-G GGGCGA-AGA C-AAGUCGUU A|UGGC|CCU CAU------- ---------G 3841 A-A-CU-GGG CU-AUA--GA -CGUGCCACA AA--GACUUU A-ACAA-AGU GA--AGCGA- 3901 Uacu(--- -----)ggaG -GAGCUAAUC AUU--AAAAA AAG-UCAAAC 4021 uauuaa---a uaua-GUCGG --AUUGU-CA U-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAc-uc) G-GG-G--AC -A--UGAAG- -AAGGAAUUU 4141 C-G--AGUAA U-CGUUGA(- UCACU-AC-- --)GCAACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -GCU--AGCA 4261 -UUCGG-AA- UGAACUAA-C -CGUCUGUCG C-UGG--GAA GGA-GCUUAA cuugguggaa 4321 acuggaauga aguuuu-aac uuuuacaaa- aauuaaa--- -(------)< -uuuuuauu- 4381 uagua-ucuu ugauauuuua uuuuuaau-- uuau-uaguu uuu-uuuucg uuagauuuuu 4441 uuuaauu(ua uugcuu)aau uaaaaaguau uauuuuuguu uaaagaau-a aauacuuguc 4501 uaacaauguu aaauuuaaaa -->------- ----cgau-- uuuguuaagc aaauuagcuc 4561 uaguuaaacc aaUUAAGUAA CAUC-UCA-A AAGUCAUAGC AAGGUAGC-C GUA-CU(GGA 4621 -A)AGU-GC- UGCUGUAAAA UAAA-----| ACGAAUAGUU UAUAACCCCC CUAUAAACUA 4681 UCAUUUUUUG UAUUAAUUAC CUUUUUAAUA CAAUUUUUUA AAUUAUAUAC UUAUUAAUAC 4741 UUUACGUCCU AAUAUACAUA UAUUUUUUUU AACAAAUUAU CAAUCCUUAU UAAUUUAAAU 4801 GUAAAAUAUU UAUUUAUUUU AUAAUUUUUG UUUUUUAUUA UUUUUAUAUU AUUUUUAUAU 4861 UAUUUUUAAG GGGUUAGCUG AGUGGUUUAG CAGUAAAUUU ACACUUUACA GACAGGGUUU 4921 CGAUUACUCU ACUCCUUAUU UUUUGUUAAG AUUAAAGUUA UAUCUUUAAA UAUGAGGUAU 4981 AAUAUCUAAA CUAAUUUAUU UAUUAUUUUU AAAUUUAAUU AUAUAAAUAU UUAGGAAAAA 5041 UAAUUUAUUU AAUAUAAAAA GUAUAAUUUU UAUGAUUAAA UUUUAGUAUA AAUUAUUUUA 5101 UCACAAAAUA UAAUAUUUUA AUUUAUAUGU AUUUUCUCAU GAAACUACAG AGUUAAUUAC 5161 UGGAAUGUUA UUAAGUGAUG GUAAUUUAGA CUUAUCAAAU UCUGCAG~|| ||| // LOCUS (5)-CHYTRI 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.All.mac 5213 bp RNA RNA 11-JAN-191 DEFINITION Allomyces macrogynus. ACCESSION No information KEYWORDS No information. SOURCE Allomyces macrogynus. ORGANISM Allomyces macrogynus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U23935 U41288(complete mt. genomic seq.) LOCUS AMU23935 1723 bp DNA PLN 20-APR-1995 DEFINITION Allomyces macrogynus small subunit ribosomal RNA (rns) gene, mitochondrial gene encoding mitochondrial rRNA subunit, complete sequence. ACCESSION U23935 KEYWORDS . SOURCE Allomyces macrogynus. ORGANISM Mitochondrion Allomyces macrogynus Eukaryotae; mitochondrial eukaryotes; Metazoa/Eumycota group; Eumycota; Chytridomycotina; Chytridiomycetes; Blastocladiales; Blastocladiaceae; Allomyces. REFERENCE 1 (bases 1 to 1723) AUTHORS Paquin,B., Forget,L., Roewer,I. and Lang,B. TITLE Molecular phylogeny of Allomyces macrogynus: congruency between nuclear ribosomal RNA- and mitochondrial protein-based trees JOURNAL J. Mol. Evol. (1995) In press REFERENCE 2 (bases 1 to 1723) AUTHORS Lang,B. TITLE Direct Submission JOURNAL Submitted (31-MAR-1995) B. Franz Lang, Biochimie, Universite de Montreal, C.P. 6128, succ. Centre-Ville, Montreal, Quebec H3C 3J7, Canada COMMENT NCBI gi: 777406 FEATURES Location/Qualifiers source 1..1723 /mitochondrion /strain="Allomyces macrogynus his1 3-35 (35oC)" /organism="Allomyces macrogynus" /cell_line="ATCC 46923" rRNA 1..1723 /gene="rns" /note="SSU rRNA" /product="small subunit ribosomal RNA" BASE COUNT 547 a 305 c 417 g 454 t ORIGIN BASE COUNT 547 a 305 c 417 g 454 t 3490 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- -------uua auuuuGAGUU 661 (UGA-)U-CU U|GGCUC-UG AAUGAACGCU -A-GCUA-UU |GA-CU--UA ACAC-A-UGC 721 -UAGUC-A-G AAu--|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------uuu u)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- --------|- 961 ---aU-UC|G GCGUAAAGGU GAGUAA--au c|uag-gaga --aa---aac caaug-aaGU 1021 GAGCCCC--- ---C---(UU CG--)---G- -------GGG UUUUACA-uu uucguuugga 1081 aaaacuaccu uauaaauaga g--------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- ---------- ---------- 1261 --------ua cggaaacgug uacguauga- -aucauguaa ca-------- -GGGUUAA-- 1321 -auc--ucug uaugguuaau acguuaugaa cucguuuaua agaugugccu agaaaggauu 1381 agaga|---- aaucga-UGA U|CCUU-AGC UG|---AUCU (GAAA--)GG AUGGUCAGU| 1441 CACAGU-GGA AC(UGAA-AU AA-)GGACCA C|ACAAUc-( agag-)-uAU UGG----C-A 1501 GCA|GUG-GG GAAUCUUGGA C-AAUCAGC( ---------- --caaugc)G CUGGA-UCC| 1561 A|-GUCA-A- AU-AGC---- -AUGGAGAAA --AAgc-aa- (--------- -ugc------ 1621 --------)- uuga----UC -UCC|----- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 -----UAAAG GAAAUGAGGA UAA------- -(-------- )--------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- UGACUGAAAU UUCCUGAAUA GUCCC|-GGC 1921 -AAA-U---C UCGU-G(-CC AGCAGCC-GC -GGU-AA)-U ACGAGA|--- -GGG-GCG-- 1981 AGCG-UGAGU CCU--AAUUA UUCGGC|GUA AAGAGUAAA- -AAGGCG|gu aaug------ 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- -gaaggcauc cccugcccgg 2221 gggugucucc uguaauacau auacggucuu uuggucc--- -gugugag|a uguaaac-u- 2281 ------AGAG -UAAAAUAGA -GGAGA--GU -----|AGAA UUGAAA-GUG ---UAAGG(A 2341 UGAAA)UCU- AGA---AAUA UUUU-CAG-G AAU------- ----AUCAAU -AGC(-GAAG 2401 -)GC|A---- ----ACUCUC U-UGGUU-AU UA---CUGAC GCU--GAAUU ACGAA-AGUG 2461 U-GGG---GA GCAAAUCAG( AUUAGAGAC) CUGA-GUAG| -UCCA-CAC- CCUAAA-CGA 2521 U--GAA-UGU |UC|GAAGAG GAU---(-AA UA-------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)----AU CCCCUUC-CU ACC(UAAC)G GGUUAAACAU 2701 U-C|--C|GC C-UGAG-GAG UAAGAUC(-- -GCAA--)GA UUG--AAACU CAAAAGAU-U 2761 AG|UCGGUC- UCUCAC---A CCAGCAGU|G AAGCAUGA-A |GUUUAA-UU UG(AUGAUAC 2821 G--------- ----)CAAAG A-ACCUUACC UAUCUUUGAC A--------- ---------- 2881 (-------au u-u)------ ---------- -------<-- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ->-------- ---C---AGG CGU-UG|CA- 3121 |UG|-GC--U |G------UC GU-CA|G-UU CGU-|GUU(G --UGA)AACG U----(-u-u 3181 uau)------ ---ACGAACA AAA-CCCCAG ---------- ---------- ---------- 3241 ------ ---|------ --------GU -CAGAGAcCA (ACAU-U)UG UCU-UUUGAA 3781 U----UCA-G GGACUA-CGU C-AAGUCAUU A|UGAC|CCA UAU------- ---------A 3841 G-A-UA-GGG CU-AAA--UU -CGUGCCACU AG--AAGAAA U-ACAA-AGG GA--AACAA- 3901 Uaga<----- -----ggaua auugaacucc guuga----- ---------- ---------- 3961 ---------- ----->(--- -----)acuG -GAGGAAAUC CCU--AAAAU UUC-UUagg- 4021 ---------- -----UUCAG --ACAGG-AC C-U(------ ---------- ---------- 4081 ---------- ---------- UGAAAu-uc) A-GG-U--CC -U--CGAAG- -UAGGAAUUG 4141 C-U--AGUAA U-CGUGAA(- UCAGCCAC-- --)GUCACGG U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UAA--AAUC 4261 -UGAGA-GA- UGAACUAA-C -CGUCCGUCA U-AGU--CUG GGA-AUCAAU Cug-guu-ug 4321 aaguaggaaa gagacc-aag aaauauca-a aaugg----- --------<- auugaaaa-a 4381 uc-cg-agca cacccguagg guguuuuc-- uaaa-ucucg guc-auggua ucgaaucaaa 4441 ccuc-gaaag ggguguaaga caucaacacc uucaaggcga cguaacacgu cgauuuuugg 4501 gcagauugau ggaugcuuag a>---ggauu guuuuga--a auaagcuuau cgucgauguu 4561 cuauuauuau uGAUUGGUGA CUGG-AUU-A AAGUCGUAGC AAGGUCGG-G UUA-CG(GG- 4621 AA)CGU-GG- UCCGGAAUGG UUAAAUGA-| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (4)-METAZO 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (5)-EUMETA 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (6)-BILATE 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (7)-COELOM 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (8)-DEUTER 5213 bp RNA RNA 25-JAN-1994 DEFINITION DEUTEROSTOMIA. ACCESSION No information KEYWORDS No information. SOURCE DEUTEROSTOMIA. ORGANISM DEUTEROSTOMIA. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (9)-CHORDA 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (10)-CEPHA 5213 bp RNA RNA 25-JAN-1994 DEFINITION CEPHALOCHORDATA. ACCESSION No information KEYWORDS No information. SOURCE CEPHALOCHORDATA. ORGANISM CEPHALOCHORDATA. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.B.lance 5213 bp RNA RNA 03-JUL-1998 DEFINITION Mitochondrion Branchiostoma lanceolatum.; 12S ribosomal RNA; 12S rRNA gene; 16S ribosomal RNA; 16S rRNA gene; ATPase 6 gene; ATPase 8 gene; COII gene; COIII gene; cytb gene; cytochrome b; cytochrome c oxidase subunit II; cytochrome c oxidase subunit III; NADH dehydrogenase subunit 2; NADH dehydrogenase subunit 3; NADH dehydrogenase subunit 4; NADH dehydrogenase subunit 4L; NADH dehydrogenase subunit 5; NADH dehydrogenase subunit 6; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; tRNA-Ala gene; tRNA-Arg gene; tRNA-Asn gene; tRNA-Asp gene; tRNA-Cys gene; tRNA-Gln gene; tRNA-Glu gene; tRNA-Gly gene; tRNA-His gene; tRNA-Ile gene; tRNA-Leu gene; tRNA-Lys gene; tRNA-Met gene; tRNA-Phe gene; tRNA-Pro gene; tRNA-Ser gene; tRNA-Thr gene; tRNA-Trp gene; tRNA-Tyr gene; tRNA-Val gene. ACCESSION Y16474 KEYWORDS 12S ribosomal RNA; 12S rRNA gene; 16S ribosomal RNA; 16S rRNA gene; ATPase 6 gene; ATPase 8 gene; COII gene; COIII gene; cytb gene; cytochrome b; cytochrome c oxidase subunit II; cytochrome c oxidase subunit III; NADH dehydrogenase subunit 2; NADH dehydrogenase subunit 3; NADH dehydrogenase subunit 4; NADH dehydrogenase subunit 4L; NADH dehydrogenase subunit 5; NADH dehydrogenase subunit 6; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; tRNA-Ala gene; tRNA-Arg gene; tRNA-Asn gene; tRNA-Asp gene; tRNA-Cys gene; tRNA-Gln gene; tRNA-Glu gene; tRNA-Gly gene; tRNA-His gene; tRNA-Ile gene; tRNA-Leu gene; tRNA-Lys gene; tRNA-Met gene; tRNA-Phe gene; tRNA-Pro gene; tRNA-Ser gene; tRNA-Thr gene; tRNA-Trp gene; tRNA-Tyr gene; tRNA-Val gene. SOURCE Mitochondrion Branchiostoma lanceolatum. ORGANISM Mitochondrion Branchiostoma lanceolatum. REFERENCE 1 (bases 1 to 15076) AUTHORS Spruyt,N., Delarbre,C., Gachelin,G. and Laudet,V. TITLE mitochondrial genome : relations to vertebrates Complete sequence of the amphioxus (Branchiostoma lanceolatum) JOURNAL Nucleic Acids Res. 26, 3279-3285 (1998) STANDARD No information REFERENCE 2 (bases 1 to 15076) AUTHORS Laudet,V. TITLE Direct Submission JOURNAL Submitted (11-FEB-1998) V. Laudet, Ecole Normale Superieure de Lyon, CNRS UMR 49, 46 Allee d'Italie, 69364 Lyon Cedex 07, FRANCE STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Y16474 Related sequence: Y09524. BASE COUNT 257 a 126 c 192 g 269 t 4369 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- -gugcAGAUU 661 (UGA-)U-UC U|GGUUU-CA AUU-AUAAAG -G-GGUU-AC |UG-AU--GA -UAC-A-UGC 721 -UAAU----- -----|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------cgu u)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- AUGCACCAGU GAGAG---au g|ggg-gcgc --uaaga--- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- --(----guu uaag-)---- 1261 ---------- ---------- --uc--uuaa -cgcaaauug |--------- aAGCAUAU-- 1321 ---------- -----(uauu g--------- ---------- ---------- ------)--- 1381 -----|---- ---uu--auu u|GCUUU-GU --|------- (-cuu--)-- -------AC| 1441 CACU------ ---------- ---------- -|-cuau--( acag-)--ca ag-------A 1501 GCA|GUA-CU UAAUAUUGGU G-AAGGUGU( ---------- ----GAGA)G CAUGC-UUC| 1561 A|-GCA--G- UG-GUUauac u--------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- agugu|-GGC 1921 -aaa-g---A UUGU-G(-CC AGCCGCC-GC -GGU-UA)-C ACcuga---- -aca-aau-- 1981 AUUUA-UAAU A--------- -cacguaucu ------guaa -uuuucaua- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ------gcaa guuaag--au ------u--- --aucu-aa- -----gag-g 2341 ugaug--ucg uau---gcuu ucuc-guuug uaa------- ---------- ---------- 2401 ---------- ----aucuua aaag------ ---------u guu-aauuac ACGAA--GUA 2461 A-AGG---UA UAAACCAGG( AUUAGAGAC) CCUG-CUAU| -UCUU-UAC- ---------- 2521 ---------- |--|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- ---------- -----uaguu 2701 a-a|--C|AG U-UGGU-UAG UACGAAU(-- --uau--)GU UUG--AAAAC UAAAGAUU-U 2761 UG|GCAGUG- GGUAAUG-UC UAUUCAGA|G GAGUUUGU-U |CAGUAaaaU CG(AUAAUCC 2821 G--------- ----)CGAGG A--UCUUACU CUAUUUGGUG ---------- ---------- 2881 (--------- uu-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---AAC UUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CU AAU-|guc(a --uaa)ggg- -----(ugu- 3181 aa-)------ G-AAUUAGCU AAG-agau-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ---ggau--- 3781 ---------A UCUAAA-CGU C-AGGUCAGG G|UGUA|GUC AAU------- ---------A 3841 G-U-AG-AG- GU-UGG--AA -UGAAUUACA GU--uauu-- ---------- ---------- 3901 ---------- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- uag-caaua- 4021 ---------- ------CCGG --AUAUU-AC UcA(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) U-AG-U--AA -U--UGAAG- -UUGGAUUUG 4141 G-U--UGUAA A-UUUGUA(- UUAUG-AU-- --)GAUAUAU U-GAC----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -ugu--agcg 4261 cUUAUC-UA- UGCACACA-C -CGCCCGUCA U-UUU--CCU g--------- ---------- 4321 ---------- ---------- ---------- ---------- ---------< --aaaucau- 4381 aa-------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---------- -AGG-AAA-G AAGUCGUAAC AAGGUAGG-G CAU-CC(GGA 4621 -A)GGA-UC- CCCUGGGGAA UUAUA----| ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- -------~|| ||| // LOCUS (10)-VERTE 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (11)-AGNAT 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.Pet.mar 5213 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Petromyzon marinus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Petromyzon marinus. ORGANISM Mitochondrion Petromyzon marinus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U11880 DEFINITION Petromyzon marinus mitochondrion, complete genome. SOURCE sea lamprey ORGANISM Mitochondrion Petromyzon marinus Eukaryotae; Hyperchondria; Eukaryote crown group; Metazoa/Eumycota group; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Vertebrata; Petromyzontiformes; Petromyzontidae; Petromyzon. REFERENCE 1 (bases 1 to 16201) AUTHORS Lee,W.-J. and Kocher,T.D. TITLE Complete sequence of a sea lamprey (Petromyzon marinus) mitochondrial genome: A unique gene order and significance for the evolution of mitochondrial genome structure JOURNAL Unpublished REFERENCE 2 (bases 1 to 16201) AUTHORS Lee,W.-J. TITLE Direct Submission JOURNAL Submitted (06-JUL-1994) Woo-Jai Lee, Zoology, University of New Hampshire, Spaulding Life Science Building, Durham, NH 03824, USA COMMENT NCBI gi: 515484 FEATURES Location/Qualifiers tRNA complement(1195..1265) /product="tRNA-Pro" /anticodon=(pos:1231..1233,aa:Pro) tRNA 1276..1343 /product="tRNA-Phe" /anticodon=(pos:1309..1311,aa:Phe) rRNA 1344..2243 /product="12S ribosomal RNA" tRNA 2244..2314 /product="tRNA-Val" /anticodon=(pos:2276..2278,aa:Val) rRNA 2315..3935 /product="16S ribosomal RNA" tRNA 3936..4009 /product="tRNA-Leu" /anticodon=(pos:3971..3973,aa:Leu) /note="UUR" tRNA 5003..5071 /product="tRNA-Ile" /anticodon=(pos:5033..5035,aa:Ile) tRNA complement(5074..5144) /product="tRNA-Gln" /anticodon=(pos:5110..5112,aa:Gln) tRNA 5145..5212 /product="tRNA-Met" /anticodon=(pos:5176..5178,aa:Met) tRNA 6256..6323 /product="tRNA-Trp" /anticodon=(pos:6285..6287,aa:Trp) tRNA complement(6325..6393) /product="tRNA-Ala" /anticodon=(pos:6334..6336,aa:Ala) tRNA complement(6397..6465) /product="tRNA-Asn" /anticodon=(pos:6434..6436,aa:Asn) tRNA complement(6467..6532) /product="tRNA-Cys" /anticodon=(pos:6502..6504,aa:Cys) tRNA complement(6538..6608) /product="tRNA-Tyr" /anticodon=(pos:6574..6576,aa:Tyr) tRNA complement(8154..8224) /product="tRNA-Ser" /anticodon=(pos:8189..8191,aa:Ser) /note="UCN" tRNA 8226..8294 /product="tRNA-Asp" /anticodon=(pos:8256..8258,aa:Asp) tRNA 8996..9061 /product="tRNA-Lys" /anticodon=(pos:9024..9026,aa:Lys) tRNA 10695..10764 /product="tRNA-Gly" /anticodon=(pos:10725..10727,aa:Gly) tRNA 11120..11185 /product="tRNA-Arg" /anticodon=(pos:11150..11152,aa:Arg) tRNA 12856..12924 /product="tRNA-His" /anticodon=(pos:12886..12888,aa:His) tRNA 12925..12994 /product="tRNA-Ser" /anticodon=(pos:12952..12954,aa:Ser) /note="AGY" tRNA 12995..13066 /product="tRNA-Leu" /anticodon=(pos:13028..13030,aa:Leu) /note="CUN" D-loop 15368..15858 tRNA 15859..15930 /product="tRNA-Thr" /anticodon=(pos:15891..15893,aa:Thr) tRNA complement(15932..16002) /product="tRNA-Glu" /anticodon=(pos:15968..15970,aa:Glu) repeat_region 16003..16201 source 1..16201 /organism="Petromyzon marinus" /dev_stage="adult" /mitochondrion CDS 1..1191 /note="NCBI gi: 515485" /product="cytochrome b" /codon_start=1 /translation="MSHQPSIIRKTHPLLSLGNSMLVDLPSPANISAWWNFGSLLSLC LILQIITGLILAMHYTANTELAFSSVMHICRDVNNGWLMRNLHANGASMFFICIYAHI GRGIYYGSYLYKETWNVGVILFALTAATAFVGYVLPWGQMSFWGATVITNLISAMPYV GNDIVVWLWGGFSVSNATLTRFFTFHFILPFILAAMTMIHIMFLHQTGSSNPMGINSN LDKIQFHPYFSFKDILGFVILLGILFMISLLAPNALGEPDNFIYANPLSTPPHIKPEW YFLFAYAILRSVPNKLGGVVALAAAIMILLIIPFTHTSKQRGMQFRPLAQITFWILIA DLALLTWLGGEPAEYPFILMTQIASTVYFMIFILVFPILGYLENKMLLMSKNTGKFNW KLVY" CDS 4014..4979 /note="NCBI gi: 515486" /product="NADH dehydrogenase subunit 1" /codon_start=1 /translation="MLIMLTSTLILVLMVLLAVAFLTMVERKTLGYMQLRKGPNVVGF MGLLQPIADGVKLFLKEPVWPLAASPILFIVAPIMALTLALSLWMLIPMPQSISTINI TLLVIMAISSLSVYAILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLCLVILTG SFSLQAFIYTQEHTWFLLSSWPLAAMWFVSTLAETNRTPFDLTEGESELVSGFNVEYA GGPFALFFLAEYSNILFMNTLTAIMFLGPLGSNNLNILPIINIMMKATPLIILFLWIR ASYPRFRYDQLMHLMWKNFLPLNLALFTLQLSLAVSFGGAGVPQM" CDS 5214..6257 /note="NCBI gi: 515487" /product="NADH dehydrogenase subunit 2" /codon_start=1 /translation="MLSPLIQSTLLMTLGLGTLVTFSSTSWILAWIGLEINTIAIIPL MAKTHHPRSIEATTKYFIAQSAGSATLLITACLTAWYSGNWAISPSNDPIILNAMTLA LMLKLGMAPMHFWLPEVMVGLDFITGMILATWQKLAPITLLIQIAQDQNNMFILIPAL LSVFVGGWGGLNQTQTRKILAYSSIAHMGWITSMAPFNPTITWLTTLIYCLITSATFI NLHILKANKITALTMNKHNQISQMLLLLLLLSLGGLPPLTGFINKLLASIELANQNLI IYLFMMMMGSLLSLFFYTRMCYLSIILSPPCSTTNLILWRVVSNKPMTLITMLSTNLF IMTPQLLAVFTLH" CDS 6610..8163 /note="GTG start codon. NCBI gi: 515488." /product="cytochrome oxidase subunit I" /codon_start=1 /translation="MTHIRWLFSTNHKDIGTLYLIFGAWAGMVGTALSILIRAELSQP GTLLGDDQIFNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSF WLLPPSLLLLLASAGVEAGAGTGWTVYPPLAGNLAHTGASVDLTIFSLHLAGVSSILG AVNFITTIFNMKPPTMTQYQTPLFVWSVLITAVLLLLSLPVLAAAITMLLTDRNLNTS FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVAYYAGKKEPFGYMGMVWA MMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGKIVW HTPMLWALGFIFLFTVGGLTGIVLSNSSLDIILHDTYYVVAHFHYVLSMGAVFAIMAG FVHWFPLFTGYTLNETWAKAHFIIMFAGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTW NIISSIGSTVSLIAVMLFMFILWEAFSAKRKAIATDLLNTNLEWLHGCPPPYHTYEEP AFVQTNFKK" CDS 8298..8987 /note="NCBI gi: 515489" /product="cytochrome oxidase subunit II" /codon_start=1 /translation="MAQQAQLGLQDAASPIMEELIHFHDHTLTVVFLISVLIFYLIIV MVTTTFMNKHSLDSQEVEIVWTVMPAIVLITIALPSLRILYLTDEISNPHLTIKAVGH QWYWSYEYTDYHQMEFDSYMIPTNELEPGGIRLLDVDHRIVVPMESPVRMLITSEDVI HSWTIPSLGTKVDAVPGRLNQATFITTRPGLFFGQCSEICGANHSFMPIALEAVPLSN FENWTTKVLAS" CDS 9064..9231 /note="NCBI gi: 515490" /product="ATPase 8" /codon_start=1 /translation="MPQLDPAPWFSMLTVSWLIIFLLIMPTILFYQPQNTISTKQVTK PKQSTWTWPWH" CDS 9222..9935 /note="NCBI gi: 515491" /product="ATPase 6" /codon_start=1 /translation="MTLDIFDQFTSPTMFGLPLAWLAMLAPSLMLVSQTPKFIKSRYH TLLTPILTSIAKQLFLPMNQQGHKWALICMASMMFILMINLLGLLPYTYTPTTQLSMN MGLAVPLWLATVLIGLQKKPTEALAHLLPEGTPAALIPMLIIIETISLFIRPIALGVR LTANLTAGHLLMQLVSMTTFVMIPVISISIITSLLLLLLTILELAVAVIQAYVFILLL TLYLQENVYVPPSSCMPHG" CDS 9901..10686 /note="NCBI gi: 515492" /product="cytochrome oxidase subunit III" /codon_start=1 /translation="MSHQAHAYHMVDPSPWPLTGAGAALLMTSGLAMWFHKNSCILMT LGLILMLLTMYQWWRDIVREGTFLGHHTSPVQQGLRYGMILFIISEVCFFAGFFWAFY HASLAPTPELGLTWPPTGINPLNPFEVPLLNTAVLLASGVSVTWAHHSITEKNRTETT QALTLTVLLGLYFTALQIMEYYETPFTMADGVYGSTFFVATGFHGLHVIIGSLFLLTC LLRHLQYHFTSKHHFGFEAAAWYWHFVDVVWLFLYISIYWWGS" CDS 10765..11115 /note="NCBI gi: 515493" /product="NADH dehydrogenase subunit 3" /codon_start=1 /translation="MNSFMVMIMLTLTLSSIMALLAFWLPIMKPDSEKLSPYECGFDP QGSARLPFSLRFFLVAILFLLFDLEIALLLPSPWATNISNPEFTLLWASLFVLLLTLG LIYEWLQGGLDWAE" CDS 11194..11484 /note="NCBI gi: 515494" /product="NADH dehydrogenase subunit 4L" /codon_start=1 /translation="MPTTLIFTSFFLALLGLSLQRKHLLSLLLTLESMALALYVSTAL WALNNTSLPIMAAPLIILTFSACEAGMGLSLMIATARTHNTDQLKALNLLKC" CDS 11478..12854 /note="NCBI gi: 515495" /product="NADH dehydrogenase subunit 4" /codon_start=1 /translation="MLKLIIPSIMLIPMTFLINKKSLLWTATTFFSFLIAALSTLTLN MDVAEHNSTNPLLSIDQFSCPLIMLSCWLLPLTIMGSQAHMKTEPITRQKTMISLLIL LQVLLCITFGASNLLMFYIAFETTLIPTLLIITRWGNQKERLTAGLYFLFYTLSASLP LLLALIMIQTHLNSLSIYIIPLSNLTLLLNTPWSETLWWIACFLAFLIKMPLYIFHLW LPKAHVEAPIAGSMILAAILLKLGGYGMIRMSSLFIPLTKDLAVPFMIIAMWGMIVTS SICLRQTDLKSMIAYSSVSHMGLVVAGIFTMTPWAWSGALAMMIAHGLVSSGLLCLAN ITYERTHTRSIFMNRGLKTLFPLMSFWWLMMTFANMALPPFPNFMAEILIITSLFNWS NWTILLLGLSMTLTALFSLNMLIMTQHEHPNKHAPVNPSTTREHLLMLMHMAPIILLI ANPSAIMI" CDS 13068..14864 /note="NCBI gi: 515496" /product="NADH dehydrogenase subunit 5" /codon_start=1 /translation="MNSHYLTLIMNSGALLTIIVLLPPIIMPKPSMILTTKLVKISMF ISLIPLTIYLNENMETTLTMKPWMDWALFNIALSFKIDKYTVIFTPIALMITWSIMEF SQWYMAKERHMDKFFKYLLLFLITMITFISANNLLQLFIGWEGVGIMSFLLISWWSGR TKANISALQAVAYNRIGDIGLMMSMVWMCSNTNSWDLQQITMLLSDQQYLIPTLGFLI AATGKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLIRLHPLFQNYPLMLEM TLCLGAMTTICAALCATTQNDIKKIIAFSTSSQLGLMMVAVGLNHPHIAFLHMCTHAF FKAMLFLCSGSIIHNMNNEQDIRKFSCLNNNLPLTTTCMTIGSAALMGLPFLAGFFTK DLILEALNTSYTNAWALMVTLMAVTLTTAYSSRLIIMSASGTPRYLPLTPTHENNFIK NPLKRLAWGSLISGLILTSTLPPMKPQIFTMPTYIKTIALMMFIISLIISMELTNKKI NQTTFSFFTQLAFYPHIIHRLTSHLSLIWSQKLMTQVMDVSWLEKIGPKGLANHQLKP STTLTEAHHLNSATLPLMAFALTLITLSLTAR" CDS complement(14849..15367) /note="NCBI gi: 515497" /product="NADH dehydrogenase subunit 6" /codon_start=1 /translation="MLSLVLCFFVMFLLGVAVVVLSPSPYFSALGLVFVAVSGCFIVL YHGGTFLSLVLVLLYLGGMMVVFVYSAALAADPYPEVLGGRVIWFFVICVLCICFAGY MSFNDFFLDVSVACEGADYTGGIFGAEWLGVTTFYEVGLILVLAGWALLVCLFSVLVV VRGVNRGALRAV" BASE COUNT 301 a 234 c 168 g 197 t 4313 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --caaAGGAU 661 (UAG-)U-UC C|AGCCU-UA AUA-UCAACU ---AUAU-AU |GAaau--ua -CAC-A-UGC 721 -AAGu----- -----|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------uuc c)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- gCACUCCCGU GAGGA--cCU C|CUU-Uaa- --cu-au--- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- --(-----aa ac---)---- 1261 ---------- ---------- --au--aa-- --aAAAGAGA |--------- uGGUAUCA-- 1321 -GGCuc-ac- -----(aaaa a--------- ---------- ---------- ------)--- 1381 --guc|---A GCCCA--CAA C|ACCUA-gc --|------- (--ca--)-- -------cC| 1441 CACA------ ---------- ---------- -|-CCCU--( CAAG-)--GG UAcu---C-A 1501 GCA|GUG-AU AAACCUUAAG C-AAUGGGC( ---------- ----GCAA)G CCCGA-CUA| 1561 A|-GUU--A- CA-UAUuuua ---------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- GAGCU|-GGU 1921 -AAA-C---C UCGU-G(-CC AGCCACC-GC -GGU-UA)-U ACGAGG|--- -AGC-UCA-- 1981 AGCUG-AUAU C--------- ucCGGC|acA AAGCGUGAUU -A-aaa---- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 --uauuuagc -uuaauuaau acuaua--ga -----|Agcc aucaug-ccu ----gCUA(G 2341 UUAAA)UAGG UA-------u gccu-aagua --u------- ----cccaac -aUC(-GAAA 2401 -)GA|a---- ----ucuaua uuaauaagc- -ucac----- uuu-gauaUC ACGAA-Agca 2461 aaacu---CA CAAACCGGG( AUUAGAUAC) CCCG-CUAU| -gccu--gc- CAUAAA--ua 2521 a--------- |--|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------a caa-ccgu-- ---------- 2701 ---|--C|GC C-aGGG-CAC UACGAAC(-- -AAUC--)GU UUA--AAACC CAAAGAAC-U 2761 UG|ACGGCA- CCCUAAA-CC CACCUAGA|G GAGCCUGU-C |CUAUAA-CC CG(AUACUCC 2821 A--------- ----)CGUUU U-ACCCAACC GCCUCUCGCC ---------- ---------- 2881 (--------- cc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---AGU CUA-UA|UA- 3121 |CC|-GC--C |G------UC GC-CA|G-CC AAC-|CUU(A --UAA)AAG- -----(aau- 3181 aa-)------ c-cGUAGGCA AAA-aagu-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- -cuaucuau- 3781 ---------a caaauA-CGU C-AGGUCGAG G|UGCA|ACC UAU------- ---------G 3841 A-G-GC-AG- GC-AGA--GA -UGGGCUACA CU--CUCU-- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--a ccc--)---- ---------- ---------- -AG-AGua-- 4021 ---------- -----uaCGA --AUaau-uu a-a(------ ---------- ---------- 4081 ---------- ---------- UGAAA----) a-aa-u--uu -u--GAAGG- --UGGAUUUA 4141 G-C--AGUAA A-CAAGAA(- -uagu-uu-- --)GUCUAGU U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -guu--gcca 4261 cUAGGG-UG- CGUACACA-C -CGCCCGUCA C-UCU--CC- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------< ----cccca- 4381 caccc----- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---------- --gG-AGA-A AAGUCGUAAC AUGGUAAG-C GUA-CC(GGA 4621 -A)GGU-GC- GCUUGGAaaa ---------| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS (11)-GNATH 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (12)-CHOND 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.S.canic 5213 bp RNA RNA 17-SEP-1998 DEFINITION Mitochondrion Scyliorhinus canicula.; 12S rRNA; 16S rRNA; ATPase 6; ATPase 8; COI gene; COII gene; COIII gene; complete genome; control region; cytb gene; mitochondrial; NADH1 gene; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; origin of replication; tRNA-Ala; tRNA-Arg; tRNA-Asn; tRNA-Asp; tRNA-Cys; tRNA-Gln; tRNA-Glu; tRNA-Gly; tRNA-His; tRNA-Ile; tRNA-Leu(CUN); tRNA-Leu(UUR); tRNA-Lys; tRNA-Met; tRNA-Phe; tRNA-Pro; tRNA-Ser(AGY); tRNA-Ser(UCN); tRNA-Thr; tRNA-Trp; tRNA-Tyr; tRNA-Val. ACCESSION Y16067 KEYWORDS 12S rRNA; 16S rRNA; ATPase 6; ATPase 8; COI gene; COII gene; COIII gene; complete genome; control region; cytb gene; mitochondrial; NADH1 gene; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; origin of replication; tRNA-Ala; tRNA-Arg; tRNA-Asn; tRNA-Asp; tRNA-Cys; tRNA-Gln; tRNA-Glu; tRNA-Gly; tRNA-His; tRNA-Ile; tRNA-Leu(CUN); tRNA-Leu(UUR); tRNA-Lys; tRNA-Met; tRNA-Phe; tRNA-Pro; tRNA-Ser(AGY); tRNA-Ser(UCN); tRNA-Thr; tRNA-Trp; tRNA-Tyr; tRNA-Val. SOURCE Mitochondrion Scyliorhinus canicula. ORGANISM Mitochondrion Scyliorhinus canicula. REFERENCE 1 (bases 1 to 16697) AUTHORS Delarbre,C., Spruyt,N., Delmarre,C., Gallut,C., Barriel,V., Janvier,P., Laudet,V. and Gachelin,G. TITLE The complete nucleotide sequence of the mitochondrial DNA of the dogfish, scyliorhinus canicula JOURNAL Genetics 150 (1), 331-344 (1998) STANDARD No information REFERENCE 2 (bases 1 to 16697) AUTHORS Gachelin,G. TITLE Direct Submission JOURNAL Submitted (30-DEC-1997) G. Gachelin, Institut Pasteur, Dept. of Immunology, 25 rue du Docteur ROUX, 75015 Paris Cedex, FRANCE STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Y16067 Related sequence Y09526. BASE COUNT 308 a 225 c 190 g 237 t 4253 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- -uguUAGGUU 661 (UGG-)U-CC U|GACCU-UA GUG-UUAAUU -G-CAAC-UA |AA-AU--UA -UAC-A-UGC 721 -AAGu----- -----|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------uuc a)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- gCCCCCCUGU GAGAA---UG C|CCU-Aa-- --gu-auu-- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- --(cuauua- -----)---- 1261 ---------- ---------- -aau--aa-- --uUAGGGGC |--------- GGGCAUCA-- 1321 -GGCACACAU -----(uuua c--------- ---------- ---------- ------)--- 1381 -AUGU|---G GCCCA--AGA C|GCCUU-GC --|------- (-uca--)-- -------GC| 1441 CACA------ ---------- ---------- -|--CCC--( UAAG-)--GG uuuu---C-A 1501 GCA|GUA-AU AAACAUUGAU uaCAUAAGC( ---------- ----GUAA)G CUUGA-AUC| 1561 A|-GUUA-A- AG-UCG---a ca-------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- GAGUU|-GGU 1921 -AAA-U---C UCGU-G(-CC AGCCACC-GC -GGU-UA)-U ACGAGU|--- -GAC-UCA-- 1981 CAUUA-ACAC U--------u ccCGGC|GUA AAGUGUGAuu -u-aag---- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -----gauga ccuccaaaua acuaua--gu -----|uaug accuca-uca ----aGCU(G 2341 UUAUA)CGCA U-------uc guga-ac--g gaa------- -uaaucaaca --AC(-GAAA 2401 -)GU|g---- ----acucua --aauuacca gg---aau-- cuu-gaugUC ACGAC-AGUU 2461 G-GGC---CC CAAACUAGG( AUUAGAUAC) CCUA-CUAU| -GCCC-UAC- CAUAAA-CUU 2521 A--GACA-AU |AC|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --c(cuac)u a---U-AUUG 2701 U-C|--C|GC C-AGAG-UAC UACAAGC(-- -GCUA--)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CCCCACA-CC CACCUAGA|G GAGCCUGU-U |CUAUA--AC CG(AUAAUCC 2821 C--------- ----)CGUUA A-ACCUCACC ACUUCUUGCC ---------- ---------- 2881 (-------au ua-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGU CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CU CAC-|CCC(G --UGA)GGG- -----(uua- 3181 aa-)------ a-aGUAAGCA AAA-aGAA-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----uuaaac 3781 ---------U CCuaAA-CGU C-AGGUCGAG G|UGUA|GCG AAU------- ---------G 3841 A-A-GU-GG- AA-AGA--AA -UGGGCUACA UU--UU-U-- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u ua---)---- ---------- ---------- ccA-AAaaa- 4021 ---------- -----UACGG --ACAGU-AA A-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA----) A-AU-U--AC -C--CAAAG- -GUGGAUUUA 4141 G-C--AGUAA G-AGAAGG(- UCAGA-GU-- --)ACUUCUC U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -ACU--GGCU 4261 CUGGGG-CG- CGCACACA-C -CGCCCGUCA C-UCU--CCU C--------- ---------- 4321 ---------- ---------- ---------- ---------- ---------< -aauaaaua- 4381 cac-u--uau (u-uuu)aua aaaau---uu u-accaaaac a--------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---------a GAGG-AGG-C AAGUCGUAAC AUGGUAAG-U GUA-CU(GGA 4621 -A)AGU-GC- ACUUGGAACC AA-------| ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS mt.M.manaz 5213 bp RNA RNA 12-SEP-1998 DEFINITION Mitochondrion Mustelus manazo.; . ACCESSION AB0159 2 KEYWORDS . SOURCE Mitochondrion Mustelus manazo. ORGANISM Mitochondrion Mustelus manazo. REFERENCE 1 (sites) AUTHORS Cao,Y., Waddell,P.J., Okada,N. and Hasegawa,M. TITLE The complete mitochondrial DNA sequence of the shark (Mustelus manazo): Evaluating rooting contradictions to living bony vertebrates JOURNAL Mol. Biol. Evol. (1998) In press STANDARD No information REFERENCE 2 (bases 1 to 16707) AUTHORS Cao,Y. TITLE Direct Submission JOURNAL Submitted (07-JUL-1998) to the DDBJ/EMBL/GenBank databases. Ying Cao, The Institute of Statistical Mathematics; 4-6-7 Minami-Azabu, Minato-ku, Tokyo 106-8569, Japan (E-mail:cao@ism.ac.jp, Tel: +81-3-5421-8748, Fax: +81-3-5421-8796) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: AB015962 BASE COUNT 316 a 215 c 184 g 241 t 4257 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- -uacaAGGUU 661 (UGG-)U-CC U|GGCCU-UA GUG-UUAAUU -G-UAAC-UA |GA-AU--UA -UAC-A-UGC 721 -AAGu----- -----|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------uuc a)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- gCCCUCCUGU GAGAA---UG C|CCU-Aa-- --uu-aau-- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- --(cuauua- -----)---- 1261 ---------- ---------- -aau--aa-- --uUAGGAGC |--------- AGGUAUCA-- 1321 -GGCACA--- -----(cgca cgu------- ---------- ---------- ------)--- 1381 ----A|---- GCCCA--AGA C|ACCUU-GC --|------- (-uaa--)-- -------GC| 1441 CACA------ ---------- ---------- -|-CCCC--( CAAG-)--GG auuu---C-A 1501 GCA|GUA-AU AAACAUUAAU u-CAUGAGC( ---------- ----GAAA)G CUUGA-AUU| 1561 A|-GUUA-A- AG-UCG---a ca-------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- GAGUU|-GGU 1921 -UAA-U---C UCGU-G(-CC AGCCACC-GC -GGU-UA)-U ACGAGU|--- -AAC-UCA-- 1981 UAUUA-ACAC A--------c ccCGGC|GUA AAGAGUGGuu -u-aag---- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -----aauga ccuuuuaaua acuaaa--gu -----|uuag accuca-uaa ----aGCU(G 2341 UUAUA)CGCA C-------uc auga-gu--g gaa------- -uaaucaaca --AC(-GAAA 2401 -)GU|g---- ----acuuua --cauauuaa gg---agc-- cuu-gaugCC ACGAU-AGUU 2461 G-AGA---CC CAAACUAGG( AUUAGAUAC) CCUA-CUAU| -GCCC-AAC- CAUAAA-CUU 2521 A--GACA-AU |AC|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --u(ucac)c a---U-AUUG 2701 U-U|--C|GC C-AGAG-UAC UACAAGC(-- -GCUA--)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUA- UCCCACA-CC CACCUAGA|G GAGCCUGU-U |CUAUG--AC CG(AUAAUCC 2821 C--------- ----)CGUUC A-ACCUCACC ACUUCUUGCC ---------- ---------- 2881 (-------au ua-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGU CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CU CAC-|CCU(G --UGA)AGG- -----(guc- 3181 aa-)------ a-aGUAAGCA AAA-aGAA-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----uuaaac 3781 ---------U CCaaAA-CGU C-AGGUCGAG G|UGUA|GCA AAU------- ---------G 3841 A-A-GU-GG- GA-AGA--AA -UGGGCUACA UU--UU-U-- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u -a---)---- ---------- ---------- ccA-AAaaca 4021 ---------- -----UACGA --AUGGU-AA A-U(------ ---------- ---------- 4081 ---------- ---------- UGAAA----) A-UA-U--AC -C--UAAAG- -GUGGAUUUA 4141 G-C--AGUAA G-AGAAGA(- UCAGA-GU-- --)ACUUCCC U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--GGCU 4261 CUGGGA-UG- CGCACACA-C -CGCCCGUCA C-UCU--CCU C--------- ---------- 4321 ---------- ---------- ---------- ---------- ---------< -aa-aaacc- 4381 uac-u--uau (u-uuu)uua uaaauacauu u--cuuuaac a--------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---------a GAGG-AGG-C AAGUCGUAAC AUGGUAAG-U GUA-CU(GGA 4621 -A)AGU-GC- ACUUGGAAUC AA-------| ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS (12)-bony 5213 bp RNA RNA 25-JAN-1994 DEFINITION bony vertebrates. ACCESSION No information KEYWORDS No information. SOURCE bony vertebrates. ORGANISM bony vertebrates. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (13)-Actin 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (14)-CHOND 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.P.ornat 5213 bp RNA RNA 30-DEC-1997 DEFINITION Mitochondrion Polypterus ornatipinnis.; . ACCESSION U62532 KEYWORDS . SOURCE Mitochondrion Polypterus ornatipinnis. ORGANISM Mitochondrion Polypterus ornatipinnis. REFERENCE 1 (bases 1 to 16624) AUTHORS Noack,K., Zardoya,R. and Meyer,A. TITLE The complete mitochondrial DNA sequence of the bichir (Polypterus ornatipinnis), a basal ray-finned fish: ancient establishment of the consensus vertebrate gene order JOURNAL Genetics 144 (3), 1165-1180 (1996) STANDARD No information REFERENCE 2 (bases 1 to 16624) AUTHORS Noack,K., Zardoya,R. and Meyer,A. TITLE Direct Submission JOURNAL Submitted (28-JUN-1996) Ecology & Evolution, State University of New York at Stony Brook, 661 Life Sciences, Stony Brook, NY 11794-5245, USA STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: U62532 BASE COUNT 295 a 228 c 203 g 224 t 4263 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---aaAGAUU 661 (UGG-)U-CC U|AGUCU-UA CUA-UCAUUU cU-CGAC-UA |AA-CU--UA -UAC-A-UGC 721 -AAGu----- -----|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------auc c)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- gCGCUCCGGU GAAAA---UG C|CCU-Caau --cu-uc--- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- --(-cuagua -----)---- 1261 ---------- ---------- --ga--gga- --uAAGGAGC |--------- UGGCAUCA-- 1321 -GGCUCGU-- -----(gucc ---------- ---------- ---------- ------)--- 1381 ---AC|--gG CCCCA--AAA C|GCCUU-GC --|------- (-uuu--)-- -------GC| 1441 CACA------ ---------- ---------- -|-CCCC--( CACG-)--GG Auuu---C-A 1501 GCA|GUA-GU AAACAUUAGG C-AAUCAGC( ---------- ----GAAA)G CUAGA-CCU| 1561 A|-GUUA-U- AG-UUA---a uua------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- GAGCC|-GGU 1921 -AAA-A---C UCGU-G(-CC AGCCACC-GC -GGU-UA)-U ACGAGG|--- -GGC-UCC-- 1981 AAAUG-AUGG U-------ua uaCGGC|GUA UGGCGUGGUU -A-aca---- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 ------a-uu -acaauaaaa acugag--aa -----|CAAA AUACCU-UUA ----AGCU(G 2341 UCAUA)CGCU AA------u- aagu-ccAUG AAA------- ----aucaac -AAC(-GAAA 2401 -)GU|U---- ----aucuca u---uaua-- ---------- ugu-gaacCC ACGAA-AACC 2461 A-AGG---CA CAAACUGGG( AUUAGAUAC) CCCA-CUAU| -GCUU-GGU- CUUAAA-CUA 2521 A--GGCG-GC |AC|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- -uu(auac)- u--AA-GCCG 2701 C-U|--C|GC C-AGGU-UAC UACGAGC(-- -GCAA--)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUCAGA-AC CACCUAGA|G GAGCCUGU-U |CUGUA--AU CG(AUAAUCC 2821 U--------- ----)CGUUC A-ACCUCACC GCAUCUUGC- ---------- ---------- 2881 (-------au uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---AGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GC-CA|G-UC UAC-|CUU(U --UGA)GAG- -----(acc- 3181 au-)------ A-AGUAGGCC CAA-UAAG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----uaaaa- 3781 ---------C UUAACA-CGU C-AGGUCAAG G|UGUA|GCU UAU------- ---------G 3841 A-U-GC-GG- GA-AGA--AA -UGGGCUACA UU--UUCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--g au---)---- ---------- ---------- UAG-AAua-- 4021 ---------- -----CACGA --AAGAC-AC U-A(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) C-UG-U--GU -C--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA A-UGGGGA(- guaga-gu-- --)GCCC-AC U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -gcuu-GGCG 4261 CUGAAG-CG- CGCACACA-C -CGCCCGUCA C-UCU--CCU CC-------- ---------- 4321 ---------- ---------- ---------- ---------- ---------< -aaacauuu- 4381 uauaa-uuuu uaauaaaaca cuuccgacaa ua-------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---------A GAGG-AGG-C AAGUCGUAAC AUGGUAAG-U GUA-CC(GGA 4621 -A)GGU-GC- ACUUGGAAUA ACC------| ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS (14)-Neopt 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (15)-TELEO 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (16)-EUTEL 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (17)-ACANT 5213 bp RNA RNA 25-JAN-1994 DEFINITION ACANTHOPTERYGII. ACCESSION No information KEYWORDS No information. SOURCE ACANTHOPTERYGII. ORGANISM ACANTHOPTERYGII. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (18)-PERCO 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.H.velif 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Histiodraco velifer.; 12S ribosomal RNA. ACCESSION Z32710 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Histiodraco velifer. ORGANISM Mitochondrion Histiodraco velifer. REFERENCE 1 (bases 1 to 373) AUTHORS Battaglia,B. and Meyer,A. Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., TITLE Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32710 NCBI gi: 530394 BASE COUNT 103 a 99 c 89 g 82 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAAA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu cc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(uuu- 3181 aaa)------ --AGUAGGCU CAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-GA-GGG -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u cu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGGU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- gua-gagc-- --)GUCCCGC U-gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.C.antar 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Cryodraco antarcticus.; 12S ribosomal RNA. ACCESSION Z32705 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Cryodraco antarcticus. ORGANISM Mitochondrion Cryodraco antarcticus. REFERENCE 1 (bases 1 to 372) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 372) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32705 NCBI gi: 530365 BASE COUNT 105 a 96 c 89 g 82 t 4841 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~~C- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(acu- 3181 a--)-----a a-AGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-AAGG-GG- -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u au---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGGU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA --gcagga(- -agua-ga-- --)gcguucu g-cug----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AAA--CUGG 4261 CUC~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.scott 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Pogonophryne scotti.; 12S ribosomal RNA. ACCESSION Z32716 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Pogonophryne scotti. ORGANISM Mitochondrion Pogonophryne scotti. REFERENCE 1 (bases 1 to 373) AUTHORS Battaglia,B. and Meyer,A. Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., TITLE Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32716 NCBI gi: 530763 BASE COUNT 104 a 99 c 88 g 82 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu cc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(uuu- 3181 aaa)------ --AGUAGGCU CAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AA-GGG -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u cu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGGU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- aua-gagc-- --)GUCCCGC U-Gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.C.mawso 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Cygnodraco mawsoni.; 12S ribosomal RNA. ACCESSION Z32706 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Cygnodraco mawsoni. ORGANISM Mitochondrion Cygnodraco mawsoni. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32706 NCBI gi: 530373 BASE COUNT 104 a 98 c 88 g 83 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(guac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUGCA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC CUUCCUUGUU ---------- ---------- 2881 (-------uu cc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)GGG- -----(ucu- 3181 aaa)------ --AGUAAGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAAAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GGG -A-AGA--AA -UGGGCUACA UU--CCCUG- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u au---)---- ---------- ---------- UAG-GGcau- 4021 ---------- ------ACGA --AUCGU-GU G-U(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) A-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- aua-gagc-- --)GUCCUGC U-gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.G.acuti 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Gymnodraco acuticeps.; 12S ribosomal RNA. ACCESSION Z32709 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Gymnodraco acuticeps. ORGANISM Mitochondrion Gymnodraco acuticeps. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32709 NCBI gi: 530379 BASE COUNT 104 a 97 c 89 g 83 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---ccccCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -ACCA--)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(ucu- 3181 aa-)------ a-aGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GG- GA-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u au---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGGU-AU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-C--AU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- guaga-gc-- --)GUCCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.charc 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Parachaenichthys charcoti.; 12S ribosomal RNA. ACCESSION Z32714 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Parachaenichthys charcoti. ORGANISM Mitochondrion Parachaenichthys charcoti. REFERENCE 1 (bases 1 to 373) AUTHORS Battaglia,B. and Meyer,A. Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., TITLE Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32714 NCBI gi: 530749 BASE COUNT 102 a 99 c 91 g 81 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GA |uu|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---acccCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -ACCA--)GC UUG--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAUA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------cc cc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(ucu- 3181 aa-)------ a-aGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAAAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GG- GA-AGA--AA -UGGGCUACA UU--CCCUG- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u gu---)---- ---------- ---------- CAG-GGCAU- 4021 ---------- ------ACGA --AUGGU-GU G-U(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) A-CA-C--AU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGGA(- gcaga-gc-- --)GUCCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.B.varie 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Bovichtus variegatus.; 12S ribosomal RNA. ACCESSION Z32702 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Bovichtus variegatus. ORGANISM Mitochondrion Bovichtus variegatus. REFERENCE 1 (bases 1 to 374) AUTHORS Battaglia,B. and Meyer,A. Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., TITLE Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 374) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32702 NCBI gi: 530362 BASE COUNT 105 a 99 c 80 g 90 t 4839 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- -~~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~---~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~-~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~~C- CCUAAA-CAU 2521 U--UAUA-GU |UC|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --c(cuac)a ---accUCUA 2701 U-U|--C|GC C-UGGA-AAC UACGAGC(-- -GCGA--)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUACA-UC CUUCUAGA|G GGACACGU-C |CUAGA--AC CG(ACAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---c---CGC CUA-UA|UA- 3121 |CC|-AC--C |G------UC GU-AA|G-CU GAC-|CCU(G --UGA)AGG- -----(aau- 3181 c--)-----a u-aGUAAGCU CAA-CUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGUCGAG G|UGUA|GUG UAU------- ---------G 3841 G-A-AA-GG- GA-AGA--AA -CGCGUCCCA UU--UUCU-- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(-au uaa--)---- ---------- ---------- -AG-AAccc- 4021 ---------- ------cCCG --AUAAU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-U--GU UUuaUGAAG- -UAGAAUUUA 4141 G-C--AGUAA G-CAGGAA(- gcaga-gc-- --)GUCCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~~ ~-~~~~~~~~ ~~~-~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~- -~~~~-~~~~ ~~~~-~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.C.acera 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Chaenocephalus aceratus.; 12S ribosomal RNA. ACCESSION Z32703 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Chaenocephalus aceratus. ORGANISM Mitochondrion Chaenocephalus aceratus. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32703 NCBI gi: 530364 BASE COUNT 105 a 96 c 90 g 82 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(acu- 3181 aaa)------ --AGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GGG -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u au---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGGU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- gua-gagc-- --)GUUCUGC U-gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -ACU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.C.hamat 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Chionodraco hamatus.; 12S ribosomal RNA. ACCESSION Z32704 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Chionodraco hamatus. ORGANISM Mitochondrion Chionodraco hamatus. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32704 NCBI gi: 530371 BASE COUNT 106 a 97 c 89 g 81 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(acu- 3181 aaa)------ --AGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GGG -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u au---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGGU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) A-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- gua-gagc-- --)GUCCUGC U-gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -ACU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.macro 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Pagetopsis macropterus.; 12S ribosomal RNA. ACCESSION Z32748 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Pagetopsis macropterus. ORGANISM Mitochondrion Pagetopsis macropterus. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze Glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32748 NCBI gi: 530754 BASE COUNT 104 a 97 c 90 g 82 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUACCCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(acu- 3181 aaa)------ --AGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GGG -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u ac---)---- ---------- ---------- UAG-GGuac- 4021 ---------- ------ACGA --AUGGU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-UA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- gua-gagc-- --)GUCCUGC U-Gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -ACU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.D.mawso 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Dissostichus mawsoni.; 12S ribosomal RNA. ACCESSION Z32707 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Dissostichus mawsoni. ORGANISM Mitochondrion Dissostichus mawsoni. REFERENCE 1 (bases 1 to 373) AUTHORS Battaglia,B. and Meyer,A. Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., TITLE Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32707 NCBI gi: 530375 BASE COUNT 106 a 94 c 88 g 85 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(uuu- 3181 aaa)------ --AGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cauag- 3781 ---------C CCAGAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GGG -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u uu---)---- ---------- ---------- UAG-GGcaa- 4021 ---------- ------ACGA --AUGAU-AU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- gua-gagc-- --)GUCCCGC U-gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.G.gibbe 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Gobionotothen gibberifrons.; 12S ribosomal RNA. ACCESSION Z32708 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Gobionotothen gibberifrons. ORGANISM Mitochondrion Gobionotothen gibberifrons. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32708 NCBI gi: 530381 BASE COUNT 106 a 96 c 87 g 84 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~GC- CGUAAA-CAU 2521 U--GAUA-GA |CC|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --a(auac)a ac--C-CCUA 2701 U-C|--C|GC C-CGGG-AAC UACGAGC(-- -AC-ca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(uuu- 3181 aaa)------ --AGUAGGCU AAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cauag- 3781 ---------C CCAGCA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AA-GGG -A-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--a uu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGAU-AU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-CA-C--AU -Cu-UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-UAGGAA(- gua-gagc-- --)GUCCUGC U-gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--GGCU 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.N.corii 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Notothenia coriiceps.; 12S ribosomal RNA. ACCESSION Z32712 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Notothenia coriiceps. ORGANISM Mitochondrion Notothenia coriiceps. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32712 NCBI gi: 530731 BASE COUNT 103 a 94 c 89 g 87 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- -~~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GA |UU|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---ccccCUA 2701 U-C|--C|GC C-CGGG-AAA UACGAGC(-- -ACCA--)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUACUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCU(A --UGA)AGG- -----(uuu- 3181 aa-)------ a-aGUAGGCU UAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAAAA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AA-GG- GA-AGA--AA -UGGGCUACA UU--CCCUG- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u uu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGGU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-C--AU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-UAGGAA(- guaga-gc-- --)GUCCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.borch 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Pagothenia borchgrevinki.; 12S ribosomal RNA. ACCESSION Z32715 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Pagothenia borchgrevinki. ORGANISM Mitochondrion Pagothenia borchgrevinki. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32715 NCBI gi: 530744 BASE COUNT 102 a 96 c 89 g 86 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GG |UU|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---accCCUA 2701 U-C|--C|GC C-CGGG-AAC UACAAGC(-- -ACAA--)GC UUG--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUCCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCC(G --UGA)GGG- -----(cuu- 3181 aa-)------ a-aGUAGGCU UAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAAUA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AA-GG- GA-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u uu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGAU-AU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-U--AU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- guaga-gc-- --)GUCCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.T.eulep 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Trematomus eulepidotus.; 12S ribosomal RNA. ACCESSION Z32717 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Trematomus eulepidotus. ORGANISM Mitochondrion Trematomus eulepidotus. REFERENCE 1 (bases 1 to 373) AUTHORS Battaglia,B. and Meyer,A. Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., TITLE Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32717 NCBI gi: 529996 BASE COUNT 101 a 95 c 90 g 87 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GG |uu|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---accCCUA 2701 U-C|--C|GC C-CGGG-AAC UACAAGC(-- -ACAA--)GC UUG--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUCCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCC(G --UGA)GGG- -----(cuu- 3181 aa-)------ a-aGUAGGCU UAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAAUA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AA-GG- GA-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u uu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGAU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-U--GU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGAAA(- guaga-gc-- --)GUUCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.T.hanso 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Trematomus hansoni.; 12S ribosomal RNA. ACCESSION Z32718 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Trematomus hansoni. ORGANISM Mitochondrion Trematomus hansoni. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32718 NCBI gi: 529998 BASE COUNT 102 a 94 c 90 g 87 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GG |uu|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---accCCUA 2701 U-C|--C|GC C-CGGG-AAC UACAAGC(-- -ACAA--)GC UUG--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUCCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCC(G --UGA)GGG- -----(cua- 3181 aa-)------ a-aGUAGGCU UAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cauaa- 3781 ---------C CCAAUA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AG-GG- GA-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u uu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGAU-GU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-U--AU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- guaga-gc-- --)GUUCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.T.nicol 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Trematomus nicolai.; 12S ribosomal RNA. ACCESSION Z32719 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Trematomus nicolai. ORGANISM Mitochondrion Trematomus nicolai. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32719 NCBI gi: 530000 BASE COUNT 101 a 93 c 90 g 89 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GG |UU|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---accCCUA 2701 U-C|--C|GC C-CGGG-AAC UACAAGC(-- -ACAA--)GC UUG--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUCCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCC(G --UGA)GGG- -----(uuu- 3181 aa-)------ a-aGUAGGCU UAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAAUA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AA-GG- GA-AGA--AA -UGGGCUACA UU--CCCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u uu---)---- ---------- ---------- UAG-GGUAC- 4021 ---------- ------ACGA --AUGAU-AU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-U--GU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- guaga-gc-- --)GUUCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.T.penne 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Trematomus pennellii.; 12S ribosomal RNA. ACCESSION Z32720 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Trematomus pennellii. ORGANISM Mitochondrion Trematomus pennellii. REFERENCE 1 (bases 1 to 373) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 373) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32720 NCBI gi: 530002 BASE COUNT 100 a 96 c 90 g 87 t 4840 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~GC- CGUAAA-CAU 2521 U--GAUA-GG |uu|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(auac)a ---accCCUA 2701 U-C|--C|GC C-CGGG-UAC UACAAGC(-- -ACAA--)GC UUG--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAGA-UC CUCCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu uc-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CC CAC-|CCC(G --UGA)GGG- -----(cua- 3181 aa-)------ a-aGUAGGCU UAA-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cacag- 3781 ---------C CCAAUA-CGU C-AGGCCGAG G|UGUA|GCG UAU------- ---------G 3841 G-A-AA-GG- GA-AGA--AA -UGGGCUACA UU--CCCUG- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--u uu---)---- ---------- ---------- UAG-GGCAC- 4021 ---------- ------ACGA --AUGCU-AU G-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-CA-U--AU CU--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGGAA(- guaga-gc-- --)GUUCUGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCU 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.L.dearb 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Lycodichthys dearborni.; 12S ribosomal RNA. ACCESSION Z32711 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Lycodichthys dearborni. ORGANISM Mitochondrion Lycodichthys dearborni. REFERENCE 1 (bases 1 to 371) AUTHORS Battaglia,B. and Meyer,A. Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., TITLE antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from Antarctica (suborder Notothenioidei) and the evolution of JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 371) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32711 NCBI gi: 530405 BASE COUNT 100 a 99 c 91 g 81 t 4842 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|----- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(~~~~~~~ -----)---- 1261 ---------- ---------- --~~--~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~~~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| ~~~~~~~~C- CCUAAA-CAU 2521 U--GAUA-GU |AC|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --c(ccac)a ---cccACUA 2701 U-C|--C|GC C-UGGG-GAC UACGAGC(-- -AGCA--)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAAA-CC CACCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAGCCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu ac-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CU UAC-|CCU(G --UGA)AGG- -----(uuu- 3181 aa-)------ u-aGUAAGCA AAA-CUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cuugg- 3781 ---------C CCAGAA-CGU C-AGGUCGAG G|UGUA|GCG CAU------- ---------G 3841 G-G-AG-GG- GA-AGA--AA -UGGGCUACA UU--CGCUG- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--c ug---)---- ---------- ---------- CAG-CGAAU- 4021 ---------- ------ACGG --ACGAU-GC A-C(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) G-UU-C--AU C---UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGAAA(- auaga-gu-- --)GUUCCGC U-GAAA---- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -UU---GGCC 4261 C~~~~~-~~- ~~~~~~~~-~ -~~~~~~~~~ ~-~~~--~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~-~~~-~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.brach 5213 bp RNA RNA 10-AUG-1994 DEFINITION Mitochondrion Pachycara brachycephalum.; 12S ribosomal RNA. ACCESSION Z32713 KEYWORDS 12S ribosomal RNA. SOURCE Mitochondrion Pachycara brachycephalum. ORGANISM Mitochondrion Pachycara brachycephalum. REFERENCE 1 (bases 1 to 371) AUTHORS Bargelloni,L., Ritchie,P., Patarnello,T., Lambert,D., Battaglia,B. and Meyer,A. TITLE Antarctica (suborder Notothenioidei) and the evolution of antifreeze glycopeptides Mitochondrial and nuclear phylogenies of fishes from JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 371) AUTHORS Bargelloni,L. TITLE Direct Submission JOURNAL Submitted (25-APR-1994) to the EMBL/GenBank/DDBJ databases. Luca Bargelloni, Biology, University of Padova, Via Trieste 75, Padova, 35121, Italy STANDARD full automatic COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: Z32713 NCBI gi: 530743 BASE COUNT 101 a 101 c 89 g 80 t 4842 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --~~~~~~~~ 661 (~~~-)~-~~ ~|~~~~~-~~ ~~~-~~~~~~ -~-~~~~-~~ |~~~~~~~~~ ~~~~-~~~~~ 721 ~~~~~~~-~~ ~~~~~|~~~~ ~~~~~~~(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------~~~ ~)~~~~~~~~ 841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 961 ~~~~~-~~|~ ~~~~~~~~~~ ~~~~~---~~ ~|~~~~~~~~ -~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~(------- -----)---- 1261 ---------- ---------- --~~~~~~~- ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 1321 ~~~~~~~~~~ ~~~~~(~~~~ ~~~------- ---------- ---------- ------)--- 1381 ---~~|---~ ~~~~~--~~~ ~|~~~~~-~~ --|~~~~~~~ (-~~~--)~~ ~~~~~~~~~| 1441 ~~~~------ ---------- ---------- -|-~~~~--( ~~~~-)~~~~ ~~~~~~~~-~ 1501 ~~~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ---------- ---~~~~~)- ----~-~~~| 1561 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~|-~~~ 1921 -~~~-~~~~~ ~~~~~~(-~~ ~~~~~~~~~~ ~~~~-~~)-~ ~~~~~~|--- -~~~~~~~-- 1981 ~~~~~-~~~~ ~~~-~~~~~~ ~~~~~~|~~~ ~~~~~~~~-- ---------- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 -~~~~~~~~~ -~~~~~~~~~ ~~~~~~--~~ -----|~~~~ ~~~~~~-~~~ ----~~~~(~ 2341 ~~~~~)~~~- ~~~------~ ~~~~~~~~~~ ~~~------- -----~~~~~ -~~~(-~~~~ 2401 -)~~|~---- ----~~~~~~ ~~~~~~~~~~ ~~---~~~-~ ~~~--~~~~~ ~~~~~-~~~~ 2461 ~-~~~---~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~-~~~~| -~~~~-~~C- CCUAAA-CAU 2521 U--GAUA-GU |AC|------ ------(--- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---)------ ---------- --c(ccac)a cc--C-ACUA 2701 U-C|--C|GC C-UGGG-AAC UACGAGC(-- -A-gca-)GC UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUUAAA-CC CACCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUC A-ACCUCACC UUUCCUUGUU ---------- ---------- 2881 (-------uu ac-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-GC--C |G------UC GU-CA|G-CU UAC-|CCU(G --UGA)AGG- -----(uuu- 3181 aau)------ --AGUAAGCU AAA-CUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----cuugg- 3781 ---------C CCAGAA-CGU C-AGGUCGAG G|UGUA|GCG CAU------- ---------G 3841 G-G-AG-GGG -A-AGA--AA -UGGGCUACA UU--CGCUG- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(--c ug---)---- ---------- ---------- CAG-CGaau- 4021 ---------- ------ACGG --ACGAU-GC A-C(------ ---------- ---------- 4081 ---------- ---------- UGAAA--C-) G-UC-C--AU -C--UGAAG- -GAGGAUUUA 4141 G-C--AGUAA G-CAGAAA(- aua-gagu-- --)GUUCCGC U-gaa----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -ACU--GGCC 4261 C~~~~~-~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~-~~~ ~~~~~~~~~- ~~~~~~~~~~ -~~~~~~~~< ~~~~~~~~~- 4381 ~~~~~-~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~~~~~~-- ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~-~~(~~~ 4621 -~)~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|| ||| // LOCUS mt.P.oliva 5213 bp RNA RNA 04-MAR-1997 DEFINITION Mitochondrion Paralichthys olivaceus.; 16S ribosomal RNA; tRNA, Val; 12S ribosomal RNA; tRNA, Phe; tRNA, Pro; tRNA, Thr; Cyt-b; cytochrome b. ACCESSION AB0006 7 KEYWORDS 16S ribosomal RNA; tRNA, Val; 12S ribosomal RNA; tRNA, Phe; tRNA, Pro; tRNA, Thr; Cyt-b; cytochrome b. SOURCE Mitochondrion Paralichthys olivaceus. ORGANISM Mitochondrion Paralichthys olivaceus. REFERENCE 1 (bases 1 to 3576) AUTHORS Saitoh,K. TITLE Direct Submission JOURNAL Kenji Saitoh, Tohoku National Fisheries Research Institute, Hachinohe Branch; Shimo-mekurakubo 25-259, Same, Hachinohe, Aomori 031, Japan (Tel:178-33-1500, Fax:178-34-1357) Submitted (24-JAN-1997) to the DDBJ/EMBL/GenBank databases. STANDARD No information REFERENCE 2 (bases 1 to 3576) AUTHORS Saitoh,K. TITLE Characterization of cloned Japanese flounder mitochondrial DNA fragments JOURNAL Unpublished (1997) STANDARD No information REFERENCE 3 (sites) AUTHORS Saitoh,K. TITLE Length variable mitochondrial control region from the Japanese flounder JOURNAL Unpublished (1997) STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: AB000667 BASE COUNT 295 a 247 c 219 g 188 t 4264 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --caaAGGCU 661 (UGG-)U-CC U|GACUU-UA CUG-UCGACU -C-UAAC-UA |GA-CU--UA -CAC-A-UGC 721 -AAGu----- -----|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------auc c)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- gCCCCCCUGU GAGAA---UG C|CCA-Uaac --gc-cc--- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- --(-ugcuc- -----)---- 1261 ---------- ---------- --gg--gaa- --cAAGGAGC |--------- UGGCAUCA-- 1321 -GGCACAGA- -----(caua ---------- ---------- ---------- ------)--- 1381 --UCU|---G GCCCA--CGA C|GCCUU-GC --|------- (-uua--)-- -------GC| 1441 CACA------ ---------- ---------- -|-CCCU--( CAAG-)--GG AAcu---C-A 1501 GCA|GUG-AU AAAUAUUAAG C-CAUAAGU( ---------- ----GCAA)A CUUGA-CUU| 1561 A|-GUUA-A- GG-UUA---a ga-------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- GGGCC|-GGU 1921 -AAA-A---C UCGU-G(-CC AGCCACC-GC -GGU-UA)-U ACGAGA|--- -GGC-CCG-- 1981 AGUUG-ACAG A--------c agCGGC|GUA AAGGGUGGUU -A-ggg---- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- --------|- ---------- 2281 ------g--- -guugaccaa acuaag--gc -----|CGAA CGCUCC-CAA ----AGCU(G 2341 UUAUA)AGCA CC------C- GGGA-GUAUG AAA------- ----cccaau -UAC(-GAAA 2401 -)GU|a---- ----gccuua u---ucac-- ---------- ccu-gaacCC ACGAA-AGCU 2461 A-AGG---AA CAAACUGGG( AUUAGAUAC) CCCA-CUAU| -GCUU-AGC- CCUAAA-CAU 2521 C--GAUU-GU |AC|------ ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ---------- ---------- ---------- --a(uuac)a c--uc-aacA 2701 U-C|--C|GC C-CGGG-AAU UACAAAC(-- -GUUA--)GU UUA--AAACC CAAAGGAC-U 2761 UG|GCGGUG- CUUAACA-UC CACCUAGA|G GAGCCUGU-U |CUAGA--AC CG(AUAACCC 2821 C--------- ----)CGUUA A-ACCUCACC CUCUCUUGCC ---------- ---------- 2881 (-------uc au-)------ ---------- ---------- ---------- ---------- 2941 ---------- ---------- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 ---------- ---------- ---------- ---------- ---C---CGC CUA-UA|UA- 3121 |CC|-AC--C |G------UC GU-CA|G-CU UAC-|CCU(G --UGA)AGG- -----(cuu- 3181 aa-)------ c-AGUAAGCA AAG-UUGG-- ---------- ---------- -----(---- 3241 --)<------ ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ------>--- ---|------ ---------- ---------- (------)-- ----caaag- 3781 ---------C CCAAAA-CGU C-AGGUCGAG G|UGUA|GUG AAU------- ---------G 3841 A-G-GG-GG- GA-AGA--AA -UGGGCUACA UU--UGCUA- ---------- ---------- 3901 ----<----- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ----->(-aa gc---)---- ---------- ---------- UAG-CAAA-- 4021 ---------- -----UACGA --AUAAU-GC A-U(------ ---------- ---------- 4081 ---------- ---------- UGAAAC---) A-UG-C--AA -U--UGAAG- -GAGGAUUUA 4141 G-U--AGUAA G-CAGGGA(- auaga-gu-- --)GUCCCGC U-GAA----- ---------- 4201 ---------- ---------- ---------- ---------- ---------- -AUU--GGCC 4261 CUAAAG-CG- CGCACACA-C -CGCCCGUCA C-CCU--CCC CA-------- ---------- 4321 ---------- ---------- ---------- ---------- ---------< -agcccuac- 4381 aagac-uaaa cuaacuaaaa ccaacaaccc gcga------ ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- -->------- ---------- ---------- ---------- 4561 ---------- ---------A GGGG-AGG-A AAGUCGUAAC AUGGUAAG-U GUA-CC(GGA 4621 -A)GGU-GC- ACUUGGAAAA AU-------| ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- ---------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- --------|| ||| // LOCUS (17)-OSTAR 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (18)-CYPRI 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (19)-CYPRI 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS (20)-CYPRI 5213 bp RNA RNA 25-JAN-1994 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 5213 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ----|..... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......-.. .......... .......... ..-....... |......... ....-..... 721 .......-.. .....|.... ........-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- ------.... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .....-..|. .......... .......... .|........ -......... .....-.... 1021 .......... ....---... ..-..---.. .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .........- .......... ..----.... ........-- 1321 .......... .......... .......... .......... .......... .......... 1381 ......---. .......... .......-.. .......... .......... .......... 1441 .......... ........-. ..-....... .......... .......... ........-. 1501 ...|...-.. .......... .......... .......... .......... .....-...| 1561 .......... .......... .......... .......... .--....... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......-.. .......... -.......-. .......... .......... 1981 .....-.... ...--..... .......... .......... -......... .......... 2041 .......... .....----. .......... .......... .....----- ---------- 2101 ---------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- --------.. .......... .......... .......... 2221 .......... .......... .......... .......... ........|. .......-.. 2281 .......... -......... ......--.. .-........ .......... ---....... 2341 .......... ...-...... ....-..... .......... .......... .......... 2401 ....|..... .......... .......... .......... .......... .....-.... 2461 .....--... .......... .......... .......... .......... .......... 2521 .--....-.. |......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .-..-..... .......... .......... .......... .......... .......... 2761 ..|....... .......... ........|. ........-. |......... .......... 2821 .--------- ----...... .-........ .......... .......... .......... 2881 .....---.. ..-....... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .--....... ...-.....- 3121 .......--. |......... .......-.. .......... .-........ .........- 3181 .......... .-........ .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .....--... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... ........-- --........ .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .....-.... .......... 3781 .......... .......... .......... ......|... ...------- -------... 3841 ...-..-... ..-....... .......... ..-....... ......-... ..--...... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... ...-...... .......... .......... .......... 4021 ......---. .......... .-........ .-........ .......... .......... 4081 .......... .......... ......-... .......... .........- .......... 4141 .-.-...... .......... .......... .......... .-........ .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .-........ ...-...... .......... 4321 .......... ......-... .........- .......... -......... .........- 4381 .....-.... .......... ........-- ....-..... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... ...--..... ........-- .......... .......... 4561 .......... .......... ........-. .......... ........-. ...-...... 4621 -.....-... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... .......... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... ........|| ||| // LOCUS mt.C.anoma 5213 bp RNA RNA 20-OCT-1997 DEFINITION Mitochondrion Campostoma anomalum.; . ACCESSION AF023184 KEYWORDS . SOURCE Mitochondrion Campostoma anomalum. ORGANISM Mitochondrion Campostoma anomalum. REFERENCE 1 (bases 1 to 956) AUTHORS Simons,A.M. and Mayden,R.L. TITLE Phylogenetic Relationships of the Creek Chubs and the Spine-Fins: an Enigmatic Group of North American Cyprinid Fishes (Actinopterygii: Cyprinidae) JOURNAL Cladistics 13 (3) (1997) In press STANDARD No information REFERENCE 2 (bases 1 to 956) AUTHORS Simons,A.M. and Mayden,R.L. TITLE Direct Submission JOURNAL Submitted (08-SEP-1997) Department of Biological Sciences, The University of Alabama, Box 870344, Tuscaloosa, AL 35487-0344, USA STANDARD No information COMMENTS Sequence information (bases 1 to 5213) Corresponding GenBank entry: AF023184 BASE COUNT 296 a 249 c 222 g 189 t 4257 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- --uaaAGGCA 661 (UGG-)U-CC U|GACCU-UA UUA-UCAGCU -U-UAAC-CU |AA-CU--UA -CAC-A-UGC 721 -AAGu----- -----|---- -------(-- ---------- ---------- ---------- 781 ---------- ---------- ---------- ---------- -------cuc c)-------- 841 ---------- ---------- ---------- ---------- ---------- ---------- 901 ---------- ---------- ---------- ---------- ---------- ---------- 961 --------|- gCAGCCCCGU GAGUA---CG C|CCU-Caa- --uc-cc--- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- ---------- 1201 ---------- ---------- ---------- ---------- --(cugcccg -----)---- 1261 ---------- ---------- --gg--ga-- --cGAGGAGC |--------- AGGUAUCA-- 1321 -GGCACAA-- -----(accc ---------- ---------- ---------- ------)--- 1381 ---UU|---A GCCCA--AGA C|GCCUG-GC --|------- (-cua--)-- -------GC| 1441 CACA------ ---------- ---------- -|-CCCC--( CAAG-)--GG AAuu---C-A 1501 GCA|GUG-AU AAAUAUUAAG C-CAUAAGU( ---------- ----GAAA)A CUUGA-CUC| 1561 A|-GUUA-A- GG-UUA---a aa-------- ---------- ---------- ---------- 1621 ---------- ---------- ---------- ---------- ---------- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- ---------- ---------- ---------- ---------- 1861 ---------- ---------- ---------- ---------- ---------- GGGCC|-GGU 1921 -AAA-A---C UCGU-G(-CC AGCCACC-GC -GGU-UA)-G ACGAGA|--- -GGC-CCU-- 1981 AGUUG-AUAG U-------au aaCGGC|GUA AAGGGUGGUU -A-agg---- ---------- 2041 ---------- ---------- ---------- ---------- ---------- ---------- 2101 ---------- ---------- ---------- ---------- --------